Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   DDE72_RS04970 Genome accession   NZ_CP029034
Coordinates   930239..930616 (+) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain LDO2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 925239..935616
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DDE72_RS04935 (DDE72_04935) - 925550..926500 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  DDE72_RS04940 (DDE72_04940) comGA 926697..927767 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  DDE72_RS04945 (DDE72_04945) comGB 927754..928791 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  DDE72_RS04950 (DDE72_04950) comGC 928838..929104 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  DDE72_RS04955 (DDE72_04955) comGD 929094..929531 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  DDE72_RS04960 (DDE72_04960) comGE 929515..929829 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  DDE72_RS04965 (DDE72_04965) comGF 929774..930238 (+) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  DDE72_RS04970 (DDE72_04970) comGG 930239..930616 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  DDE72_RS04975 (DDE72_04975) - 930673..930852 (+) 180 WP_022552966.1 YqzE family protein -
  DDE72_RS04980 (DDE72_04980) - 930893..931222 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  DDE72_RS04985 (DDE72_04985) tapA 931481..932152 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  DDE72_RS04990 (DDE72_04990) - 932124..932708 (+) 585 WP_032874025.1 signal peptidase I -
  DDE72_RS04995 (DDE72_04995) - 932773..933558 (+) 786 WP_032874027.1 TasA family protein -
  DDE72_RS05000 (DDE72_05000) sinR 933606..933941 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DDE72_RS05005 (DDE72_05005) sinI 933975..934148 (-) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  DDE72_RS05010 (DDE72_05010) - 934325..935119 (-) 795 WP_007612541.1 YqhG family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=289497 DDE72_RS04970 WP_032874019.1 930239..930616(+) (comGG) [Bacillus velezensis strain LDO2]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=289497 DDE72_RS04970 WP_032874019.1 930239..930616(+) (comGG) [Bacillus velezensis strain LDO2]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488


Multiple sequence alignment