Detailed information    

insolico Bioinformatically predicted

Overview

Name   crp   Type   Regulator
Locus tag   DDE02_RS12805 Genome accession   NZ_CP029005
Coordinates   2612662..2613369 (+) Length   235 a.a.
NCBI ID   WP_005070320.1    Uniprot ID   A0A009I7W0
Organism   Acinetobacter pittii strain AbW39     
Function   regulate competence development (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2610467..2667769 2612662..2613369 within 0


Gene organization within MGE regions


Location: 2610467..2667769
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DDE02_RS12785 (DDE02_12910) - 2610473..2611282 (+) 810 WP_086376877.1 M23 family metallopeptidase -
  DDE02_RS12790 (DDE02_12915) phnO 2611279..2611704 (-) 426 WP_086376912.1 GNAT family N-acetyltransferase -
  DDE02_RS12795 (DDE02_12920) - 2611801..2612223 (-) 423 WP_002121528.1 OsmC family protein -
  DDE02_RS12800 (DDE02_12925) - 2612302..2612421 (-) 120 WP_002121587.1 hypothetical protein -
  DDE02_RS12805 (DDE02_12930) crp 2612662..2613369 (+) 708 WP_005070320.1 cAMP-activated global transcriptional regulator CRP Regulator
  DDE02_RS12810 (DDE02_12935) tas 2613529..2614578 (+) 1050 WP_086376876.1 NADP(H)-dependent aldo-keto reductase -
  DDE02_RS12815 (DDE02_12940) - 2614633..2615412 (-) 780 WP_002121572.1 M48 family metallopeptidase -
  DDE02_RS12820 (DDE02_12945) - 2615528..2615845 (-) 318 WP_002121533.1 hypothetical protein -
  DDE02_RS12825 (DDE02_12950) purA 2615967..2617286 (-) 1320 WP_002121613.1 adenylosuccinate synthase -
  DDE02_RS12830 (DDE02_12955) hisZ 2617351..2618517 (-) 1167 WP_086376875.1 ATP phosphoribosyltransferase regulatory subunit -
  DDE02_RS12835 (DDE02_12960) - 2618707..2619791 (-) 1085 Protein_2505 hypothetical protein -
  DDE02_RS12840 (DDE02_12965) epD 2619957..2620976 (-) 1020 WP_086376874.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  DDE02_RS12845 (DDE02_12970) alaS 2621247..2623883 (+) 2637 WP_086376873.1 alanine--tRNA ligase -
  DDE02_RS12850 (DDE02_12975) - 2624170..2625372 (+) 1203 WP_104133553.1 site-specific integrase -
  DDE02_RS12855 (DDE02_12980) - 2625631..2627277 (-) 1647 WP_000960796.1 phosphoethanolamine transferase -
  DDE02_RS12860 (DDE02_12985) - 2627456..2628229 (+) 774 WP_001066070.1 membrane protein -
  DDE02_RS12865 (DDE02_12990) - 2628374..2628919 (-) 546 WP_161511821.1 glycoside hydrolase family 108 protein -
  DDE02_RS12870 (DDE02_12995) - 2628962..2629351 (-) 390 WP_002122319.1 hypothetical protein -
  DDE02_RS12875 (DDE02_13000) - 2629415..2631904 (-) 2490 WP_252618345.1 phage tail protein -
  DDE02_RS12880 (DDE02_13005) - 2631905..2632330 (-) 426 WP_161511819.1 C40 family peptidase -
  DDE02_RS12885 - 2632388..2635609 (-) 3222 WP_228718957.1 hypothetical protein -
  DDE02_RS12890 (DDE02_13015) - 2635670..2636527 (-) 858 WP_068569592.1 DUF2163 domain-containing protein -
  DDE02_RS12895 (DDE02_13020) - 2636524..2637177 (-) 654 WP_161511818.1 DUF2460 domain-containing protein -
  DDE02_RS12900 (DDE02_13025) - 2637188..2640226 (-) 3039 WP_161511940.1 phage tail protein -
  DDE02_RS12905 (DDE02_13030) - 2640329..2640634 (-) 306 WP_000249256.1 TM2 domain-containing protein -
  DDE02_RS12910 (DDE02_13035) - 2640646..2641110 (-) 465 WP_004840926.1 hypothetical protein -
  DDE02_RS12915 (DDE02_13040) - 2641193..2641420 (-) 228 WP_032060342.1 hypothetical protein -
  DDE02_RS12920 (DDE02_13045) - 2641456..2641770 (-) 315 WP_033502662.1 hypothetical protein -
  DDE02_RS12925 (DDE02_13050) - 2641777..2642544 (-) 768 WP_212510825.1 hypothetical protein -
  DDE02_RS12930 (DDE02_13055) - 2642607..2643050 (-) 444 WP_004738648.1 hypothetical protein -
  DDE02_RS12935 (DDE02_13060) - 2643043..2643525 (-) 483 WP_001287056.1 hypothetical protein -
  DDE02_RS12940 (DDE02_13065) - 2643533..2643724 (-) 192 WP_086262347.1 hypothetical protein -
  DDE02_RS12945 (DDE02_13070) - 2643734..2644117 (-) 384 WP_057066779.1 DUF4054 domain-containing protein -
  DDE02_RS12950 (DDE02_13075) - 2644127..2644510 (-) 384 WP_000877803.1 hypothetical protein -
  DDE02_RS12955 (DDE02_13080) - 2644524..2645498 (-) 975 WP_000039808.1 DUF2184 domain-containing protein -
  DDE02_RS12960 (DDE02_13085) - 2645504..2645974 (-) 471 WP_000240727.1 hypothetical protein -
  DDE02_RS12965 (DDE02_13090) - 2645988..2647187 (-) 1200 WP_252618331.1 DUF2213 domain-containing protein -
  DDE02_RS12970 (DDE02_13095) - 2647241..2647540 (-) 300 WP_000823405.1 hypothetical protein -
  DDE02_RS12975 (DDE02_13100) - 2647565..2647882 (-) 318 WP_000132372.1 hypothetical protein -
  DDE02_RS12980 (DDE02_13105) - 2647875..2648687 (-) 813 WP_161511814.1 phage minor head protein -
  DDE02_RS12985 (DDE02_13110) - 2648632..2649966 (-) 1335 WP_161511813.1 DUF1073 domain-containing protein -
  DDE02_RS12990 (DDE02_13115) terL 2649975..2651501 (-) 1527 WP_212510805.1 phage terminase large subunit -
  DDE02_RS12995 (DDE02_13120) - 2651479..2651955 (-) 477 WP_000729394.1 DUF2280 domain-containing protein -
  DDE02_RS13000 (DDE02_13125) - 2652014..2652655 (-) 642 WP_212510806.1 putative metallopeptidase -
  DDE02_RS13005 (DDE02_13130) - 2652624..2653091 (-) 468 WP_212510807.1 hypothetical protein -
  DDE02_RS13010 (DDE02_13135) - 2653103..2653294 (-) 192 WP_000134356.1 hypothetical protein -
  DDE02_RS13015 (DDE02_13140) - 2653351..2653596 (-) 246 WP_000898317.1 hypothetical protein -
  DDE02_RS13020 (DDE02_13145) - 2653936..2654154 (-) 219 WP_212510808.1 hypothetical protein -
  DDE02_RS13025 (DDE02_13155) - 2654645..2655397 (-) 753 WP_004714933.1 hypothetical protein -
  DDE02_RS13030 (DDE02_13160) - 2655408..2655809 (-) 402 WP_057077378.1 DUF559 domain-containing protein -
  DDE02_RS13035 - 2655809..2656024 (-) 216 WP_032033405.1 hypothetical protein -
  DDE02_RS13040 (DDE02_13170) - 2656194..2656547 (-) 354 WP_086313163.1 hypothetical protein -
  DDE02_RS13045 (DDE02_13175) - 2656534..2656668 (-) 135 WP_139844129.1 putative phage replication protein -
  DDE02_RS13050 (DDE02_13180) - 2656665..2657633 (-) 969 WP_212510809.1 helix-turn-helix domain-containing protein -
  DDE02_RS13055 (DDE02_13185) - 2657630..2659183 (-) 1554 WP_086313129.1 DNA cytosine methyltransferase -
  DDE02_RS13060 (DDE02_13190) - 2659180..2659500 (-) 321 WP_212510810.1 hypothetical protein -
  DDE02_RS13065 (DDE02_13195) - 2659550..2660050 (-) 501 WP_212510811.1 phage regulatory CII family protein -
  DDE02_RS13070 (DDE02_13200) - 2660470..2661201 (+) 732 WP_146125880.1 XRE family transcriptional regulator -
  DDE02_RS13075 (DDE02_13205) - 2661419..2661859 (+) 441 WP_212510812.1 hypothetical protein -
  DDE02_RS13080 (DDE02_13210) - 2661862..2662185 (+) 324 WP_000181039.1 hypothetical protein -
  DDE02_RS13085 (DDE02_13215) - 2662197..2663318 (+) 1122 WP_032063646.1 ATP-binding protein -
  DDE02_RS13090 (DDE02_13220) - 2663315..2663521 (+) 207 WP_000664312.1 hypothetical protein -
  DDE02_RS13095 (DDE02_13225) - 2663526..2664485 (+) 960 WP_212510813.1 hypothetical protein -
  DDE02_RS13100 (DDE02_13230) - 2664487..2664732 (+) 246 WP_000654847.1 hypothetical protein -
  DDE02_RS13105 (DDE02_13235) - 2664736..2665143 (+) 408 WP_032063649.1 phage protein -
  DDE02_RS13110 (DDE02_13240) - 2665140..2665349 (+) 210 WP_032063650.1 hypothetical protein -
  DDE02_RS13115 (DDE02_13245) - 2665346..2665561 (+) 216 WP_161511797.1 hypothetical protein -
  DDE02_RS13120 (DDE02_13250) - 2665563..2665778 (+) 216 WP_000362184.1 hypothetical protein -
  DDE02_RS13125 (DDE02_13255) lysC 2665988..2667268 (+) 1281 WP_002115333.1 aspartate kinase -
  DDE02_RS13130 (DDE02_13260) csrA 2667515..2667769 (+) 255 WP_000906487.1 carbon storage regulator CsrA -

Sequence

Protein


Download         Length: 235 a.a.        Molecular weight: 26526.09 Da        Isoelectric Point: 4.6573

>NTDB_id=289260 DDE02_RS12805 WP_005070320.1 2612662..2613369(+) (crp) [Acinetobacter pittii strain AbW39]
MTSNFSQLSTDALSPGQLPESVKALLKRAHINRYPKRTTIVDAGTESKSLYLILKGSVSIILREDDEREIVVAYLNPGDF
FGEMGLFEPNPQRTAEVRTRDVCEIAEISYDNFHELSKQYPDLSYAVFAQLVRRLKNTTRKMTDLAFIDVSGRIARCLID
LSSQPEAMILPNGRQIRITRQEIGRIVGCSREMVGRVLKTLEDQGMIQTDGKAILIFDASLEENTVSDDDYDDEE

Nucleotide


Download         Length: 708 bp        

>NTDB_id=289260 DDE02_RS12805 WP_005070320.1 2612662..2613369(+) (crp) [Acinetobacter pittii strain AbW39]
ATGACTTCAAATTTTTCACAACTCAGCACAGATGCTTTATCTCCGGGGCAACTACCTGAATCCGTTAAAGCATTGTTAAA
ACGTGCTCACATCAACAGATATCCAAAACGAACCACAATTGTTGATGCCGGAACAGAGTCAAAATCTTTATATTTAATTT
TAAAAGGCTCAGTTTCAATTATTTTGCGTGAAGATGACGAACGTGAAATTGTTGTTGCGTATTTAAATCCGGGCGATTTC
TTTGGGGAAATGGGGCTTTTCGAACCGAACCCTCAACGTACAGCCGAAGTTCGAACTCGTGATGTCTGTGAAATTGCAGA
GATCTCTTATGACAACTTCCACGAACTTAGCAAACAATACCCAGACTTAAGCTATGCTGTTTTTGCACAATTAGTTCGCC
GTCTAAAAAATACGACTCGTAAAATGACAGATCTTGCGTTCATTGATGTGTCTGGCCGTATTGCACGTTGCTTAATCGAT
CTATCTTCTCAACCAGAAGCAATGATTTTGCCGAATGGTCGTCAAATTCGTATTACTCGTCAAGAAATTGGCCGTATTGT
TGGATGTTCGCGTGAGATGGTTGGCCGTGTACTTAAAACCTTAGAAGATCAAGGTATGATCCAAACTGATGGTAAAGCCA
TTCTTATTTTTGATGCATCATTAGAAGAAAACACTGTTTCTGATGATGACTACGACGATGAAGAATAA

Domains

Predicted by InterproScan.

Cyclic nucleotide-binding domain (cNMP_binding)

(33-120)

Crp-like helix-turn-helix domain (HTH_Crp_2)

(152-218)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A009I7W0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  crp Acinetobacter baumannii D1279779

97.447

100

0.974
  crp Vibrio cholerae strain A1552

47.087

87.66

0.413
  crp Haemophilus influenzae Rd KW20

48.718

82.979

0.404

Multiple sequence alignment