Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | DBK22_RS07510 | Genome accession | NZ_CP028961 |
| Coordinates | 1570251..1570424 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SRCM102752 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1565251..1575424
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBK22_RS07495 (DBK22_01515) | gcvT | 1566064..1567164 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| DBK22_RS07500 (DBK22_01516) | - | 1567588..1569258 (+) | 1671 | WP_072589380.1 | DEAD/DEAH box helicase | - |
| DBK22_RS07505 (DBK22_01517) | - | 1569280..1570074 (+) | 795 | WP_015240204.1 | YqhG family protein | - |
| DBK22_RS07510 (DBK22_01518) | sinI | 1570251..1570424 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| DBK22_RS07515 (DBK22_01519) | sinR | 1570458..1570793 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| DBK22_RS07520 (DBK22_01520) | tasA | 1570841..1571626 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| DBK22_RS07525 (DBK22_01521) | sipW | 1571691..1572275 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| DBK22_RS07530 (DBK22_01522) | tapA | 1572247..1572918 (-) | 672 | WP_015240206.1 | amyloid fiber anchoring/assembly protein TapA | - |
| DBK22_RS07535 (DBK22_01523) | - | 1573177..1573506 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| DBK22_RS07540 (DBK22_01524) | - | 1573545..1573724 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| DBK22_RS07545 | comGG | 1573781..1574159 (-) | 379 | Protein_1504 | competence type IV pilus minor pilin ComGG | - |
| DBK22_RS07550 (DBK22_01525) | comGF | 1574160..1574660 (-) | 501 | WP_268892471.1 | competence type IV pilus minor pilin ComGF | - |
| DBK22_RS07555 (DBK22_01526) | comGE | 1574569..1574883 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| DBK22_RS07560 (DBK22_01527) | comGD | 1574867..1575304 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=288982 DBK22_RS07510 WP_003153105.1 1570251..1570424(+) (sinI) [Bacillus velezensis strain SRCM102752]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=288982 DBK22_RS07510 WP_003153105.1 1570251..1570424(+) (sinI) [Bacillus velezensis strain SRCM102752]
ATGAAAAATGCAAAGATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAGATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |