Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   DA377_RS05745 Genome accession   NZ_CP028439
Coordinates   1089636..1089806 (+) Length   56 a.a.
NCBI ID   WP_003152048.1    Uniprot ID   -
Organism   Bacillus velezensis strain 8-2     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 1084636..1094806
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA377_RS05720 - 1084786..1086252 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  DA377_RS05725 - 1086382..1087602 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  DA377_RS05730 - 1087609..1087950 (-) 342 WP_003152040.1 hypothetical protein -
  DA377_RS05735 degQ 1088416..1088556 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DA377_RS05740 comQ 1088687..1089673 (+) 987 WP_269768356.1 class 1 isoprenoid biosynthesis enzyme Regulator
  DA377_RS05745 comX 1089636..1089806 (+) 171 WP_003152048.1 competence pheromone ComX Regulator
  DA377_RS05750 comP 1089826..1092129 (+) 2304 WP_107890404.1 histidine kinase Regulator
  DA377_RS05755 comA 1092210..1092854 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  DA377_RS05760 - 1092876..1093259 (+) 384 WP_003152054.1 hotdog fold thioesterase -
  DA377_RS05765 mnhG 1093299..1093673 (-) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  DA377_RS05770 - 1093657..1093941 (-) 285 WP_003152057.1 Na(+)/H(+) antiporter subunit F1 -
  DA377_RS05775 - 1093941..1094417 (-) 477 WP_003152059.1 Na+/H+ antiporter subunit E -

Sequence

Protein


Download         Length: 56 a.a.        Molecular weight: 6574.54 Da        Isoelectric Point: 4.8018

>NTDB_id=284913 DA377_RS05745 WP_003152048.1 1089636..1089806(+) (comX) [Bacillus velezensis strain 8-2]
MQNLINYFLNYPDVLKKLKSNEASLIGYDSIQTQIIIKGFENYLMMGADNKKWDNE

Nucleotide


Download         Length: 171 bp        

>NTDB_id=284913 DA377_RS05745 WP_003152048.1 1089636..1089806(+) (comX) [Bacillus velezensis strain 8-2]
ATGCAGAATTTAATAAATTATTTTTTGAATTATCCTGATGTATTAAAGAAACTGAAAAGCAATGAAGCTAGCCTTATCGG
TTATGACTCTATACAAACGCAAATTATCATTAAAGGGTTTGAGAATTATTTAATGATGGGTGCGGACAATAAAAAATGGG
ATAATGAATAA

Domains

Predicted by InterproScan.

Bacillus competence pheromone ComX (ComX)

(1-42)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

52.83

94.643

0.5

Multiple sequence alignment