Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DA377_RS05735 Genome accession   NZ_CP028439
Coordinates   1088416..1088556 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain 8-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1083416..1093556
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA377_RS05710 - 1083722..1084120 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  DA377_RS05715 - 1084217..1084768 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  DA377_RS05720 - 1084786..1086252 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  DA377_RS05725 - 1086382..1087602 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  DA377_RS05730 - 1087609..1087950 (-) 342 WP_003152040.1 hypothetical protein -
  DA377_RS05735 degQ 1088416..1088556 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DA377_RS05740 comQ 1088687..1089673 (+) 987 WP_269768356.1 class 1 isoprenoid biosynthesis enzyme Regulator
  DA377_RS05745 comX 1089636..1089806 (+) 171 WP_003152048.1 competence pheromone ComX Regulator
  DA377_RS05750 comP 1089826..1092129 (+) 2304 WP_107890404.1 histidine kinase Regulator
  DA377_RS05755 comA 1092210..1092854 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  DA377_RS05760 - 1092876..1093259 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=284911 DA377_RS05735 WP_003152043.1 1088416..1088556(+) (degQ) [Bacillus velezensis strain 8-2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=284911 DA377_RS05735 WP_003152043.1 1088416..1088556(+) (degQ) [Bacillus velezensis strain 8-2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment