Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   DA376_RS11870 Genome accession   NZ_CP028437
Coordinates   2457283..2457660 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain DR-08     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2452283..2462660
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA376_RS11830 (DA376_11830) - 2452780..2453574 (+) 795 WP_007612541.1 YqhG family protein -
  DA376_RS11835 (DA376_11835) sinI 2453751..2453924 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  DA376_RS11840 (DA376_11840) sinR 2453958..2454293 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DA376_RS11845 (DA376_11845) tasA 2454341..2455126 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  DA376_RS11850 (DA376_11850) sipW 2455191..2455775 (-) 585 WP_032874025.1 signal peptidase I SipW -
  DA376_RS11855 (DA376_11855) tapA 2455747..2456418 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  DA376_RS11860 (DA376_11860) - 2456677..2457006 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  DA376_RS11865 (DA376_11865) - 2457047..2457226 (-) 180 WP_022552966.1 YqzE family protein -
  DA376_RS11870 (DA376_11870) comGG 2457283..2457660 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  DA376_RS11875 (DA376_11875) comGF 2457661..2458161 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  DA376_RS11880 (DA376_11880) comGE 2458070..2458384 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  DA376_RS11885 (DA376_11885) comGD 2458368..2458805 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  DA376_RS11890 (DA376_11890) comGC 2458795..2459061 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  DA376_RS11895 (DA376_11895) comGB 2459108..2460145 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  DA376_RS11900 (DA376_11900) comGA 2460132..2461202 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  DA376_RS11905 (DA376_11905) - 2461399..2462349 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=284860 DA376_RS11870 WP_032874019.1 2457283..2457660(-) (comGG) [Bacillus velezensis strain DR-08]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=284860 DA376_RS11870 WP_032874019.1 2457283..2457660(-) (comGG) [Bacillus velezensis strain DR-08]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment