Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   DA376_RS11835 Genome accession   NZ_CP028437
Coordinates   2453751..2453924 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain DR-08     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2448751..2458924
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA376_RS11820 (DA376_11820) gcvT 2449565..2450665 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  DA376_RS11825 (DA376_11825) - 2451088..2452758 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  DA376_RS11830 (DA376_11830) - 2452780..2453574 (+) 795 WP_007612541.1 YqhG family protein -
  DA376_RS11835 (DA376_11835) sinI 2453751..2453924 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  DA376_RS11840 (DA376_11840) sinR 2453958..2454293 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DA376_RS11845 (DA376_11845) tasA 2454341..2455126 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  DA376_RS11850 (DA376_11850) sipW 2455191..2455775 (-) 585 WP_032874025.1 signal peptidase I SipW -
  DA376_RS11855 (DA376_11855) tapA 2455747..2456418 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  DA376_RS11860 (DA376_11860) - 2456677..2457006 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  DA376_RS11865 (DA376_11865) - 2457047..2457226 (-) 180 WP_022552966.1 YqzE family protein -
  DA376_RS11870 (DA376_11870) comGG 2457283..2457660 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  DA376_RS11875 (DA376_11875) comGF 2457661..2458161 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  DA376_RS11880 (DA376_11880) comGE 2458070..2458384 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  DA376_RS11885 (DA376_11885) comGD 2458368..2458805 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=284858 DA376_RS11835 WP_032874029.1 2453751..2453924(+) (sinI) [Bacillus velezensis strain DR-08]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=284858 DA376_RS11835 WP_032874029.1 2453751..2453924(+) (sinI) [Bacillus velezensis strain DR-08]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment