Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   C9888_RS13235 Genome accession   NZ_CP028375
Coordinates   2662949..2663326 (-) Length   125 a.a.
NCBI ID   WP_014418373.1    Uniprot ID   I2C7P9
Organism   Bacillus velezensis strain W1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2657949..2668326
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C9888_RS13195 - 2658446..2659240 (+) 795 WP_014418368.1 YqhG family protein -
  C9888_RS13200 sinI 2659417..2659590 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  C9888_RS13205 sinR 2659624..2659959 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C9888_RS13210 - 2660007..2660792 (-) 786 WP_007408329.1 TasA family protein -
  C9888_RS13215 - 2660857..2661441 (-) 585 WP_014418370.1 signal peptidase I -
  C9888_RS13220 tapA 2661413..2662084 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  C9888_RS13225 - 2662343..2662672 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  C9888_RS13230 - 2662713..2662892 (-) 180 WP_003153093.1 YqzE family protein -
  C9888_RS13235 comGG 2662949..2663326 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  C9888_RS13240 comGF 2663327..2663722 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  C9888_RS13245 comGE 2663736..2664050 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  C9888_RS13250 comGD 2664034..2664471 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  C9888_RS13255 comGC 2664461..2664769 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  C9888_RS13260 comGB 2664774..2665811 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  C9888_RS13265 comGA 2665798..2666868 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  C9888_RS13270 - 2667061..2668011 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14119.10 Da        Isoelectric Point: 9.9337

>NTDB_id=284451 C9888_RS13235 WP_014418373.1 2662949..2663326(-) (comGG) [Bacillus velezensis strain W1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVKVTIQAETMTGTRREATLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=284451 C9888_RS13235 WP_014418373.1 2662949..2663326(-) (comGG) [Bacillus velezensis strain W1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGCCGGGAAACGGTTAAGGTTACAATTCAGGCGGAAACCATGACAGGCACGAGACGGGA
GGCTACCCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment