Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   C9888_RS13200 Genome accession   NZ_CP028375
Coordinates   2659417..2659590 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain W1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2654417..2664590
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C9888_RS13185 gcvT 2655230..2656330 (-) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -
  C9888_RS13190 - 2656754..2658424 (+) 1671 WP_021494309.1 SNF2-related protein -
  C9888_RS13195 - 2658446..2659240 (+) 795 WP_014418368.1 YqhG family protein -
  C9888_RS13200 sinI 2659417..2659590 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  C9888_RS13205 sinR 2659624..2659959 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C9888_RS13210 - 2660007..2660792 (-) 786 WP_007408329.1 TasA family protein -
  C9888_RS13215 - 2660857..2661441 (-) 585 WP_014418370.1 signal peptidase I -
  C9888_RS13220 tapA 2661413..2662084 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  C9888_RS13225 - 2662343..2662672 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  C9888_RS13230 - 2662713..2662892 (-) 180 WP_003153093.1 YqzE family protein -
  C9888_RS13235 comGG 2662949..2663326 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  C9888_RS13240 comGF 2663327..2663722 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  C9888_RS13245 comGE 2663736..2664050 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  C9888_RS13250 comGD 2664034..2664471 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=284449 C9888_RS13200 WP_014418369.1 2659417..2659590(+) (sinI) [Bacillus velezensis strain W1]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=284449 C9888_RS13200 WP_014418369.1 2659417..2659590(+) (sinI) [Bacillus velezensis strain W1]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment