Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   C7M30_RS15625 Genome accession   NZ_CP028218
Coordinates   3047815..3047955 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM102756     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3042815..3052955
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M30_RS15595 (C7M30_03097) yueI 3043110..3043508 (+) 399 WP_014480710.1 YueI family protein -
  C7M30_RS15600 (C7M30_03098) pncA 3043605..3044156 (+) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  C7M30_RS15605 (C7M30_03099) pncB 3044172..3045644 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C7M30_RS15610 (C7M30_03100) pdeH 3045781..3047010 (+) 1230 WP_014477835.1 cyclic di-GMP phosphodiesterase -
  C7M30_RS15615 (C7M30_03101) - 3046986..3047354 (-) 369 WP_144500544.1 hypothetical protein -
  C7M30_RS15620 - 3047468..3047593 (-) 126 WP_154796978.1 hypothetical protein -
  C7M30_RS15625 (C7M30_03102) degQ 3047815..3047955 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C7M30_RS15630 (C7M30_03103) comQ 3048140..3049039 (+) 900 WP_038828674.1 class 1 isoprenoid biosynthesis enzyme Regulator
  C7M30_RS15635 (C7M30_03104) comX 3049027..3049194 (+) 168 WP_038828676.1 competence pheromone ComX Regulator
  C7M30_RS15640 (C7M30_03105) comP 3049209..3051518 (+) 2310 WP_038828679.1 two-component system sensor histidine kinase ComP Regulator
  C7M30_RS15645 (C7M30_03106) comA 3051599..3052243 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C7M30_RS15650 (C7M30_03107) yuxO 3052262..3052642 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=283440 C7M30_RS15625 WP_003220708.1 3047815..3047955(+) (degQ) [Bacillus subtilis strain SRCM102756]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=283440 C7M30_RS15625 WP_003220708.1 3047815..3047955(+) (degQ) [Bacillus subtilis strain SRCM102756]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment