Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | C7M25_RS12175 | Genome accession | NZ_CP028211 |
| Coordinates | 2384955..2385128 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SRCM102747 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2379955..2390128
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7M25_RS12125 (C7M25_02432) | comGD | 2380075..2380512 (+) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| C7M25_RS12130 (C7M25_02433) | comGE | 2380496..2380810 (+) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| C7M25_RS12135 (C7M25_02434) | comGF | 2380719..2381219 (+) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| C7M25_RS12140 (C7M25_02435) | comGG | 2381220..2381597 (+) | 378 | WP_160223175.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| C7M25_RS12145 (C7M25_02436) | - | 2381654..2381833 (+) | 180 | WP_160223174.1 | YqzE family protein | - |
| C7M25_RS12150 (C7M25_02437) | - | 2381873..2382202 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| C7M25_RS12155 (C7M25_02438) | tapA | 2382461..2383132 (+) | 672 | WP_160223173.1 | amyloid fiber anchoring/assembly protein TapA | - |
| C7M25_RS12160 (C7M25_02439) | sipW | 2383104..2383688 (+) | 585 | WP_160223172.1 | signal peptidase I SipW | - |
| C7M25_RS12165 (C7M25_02440) | tasA | 2383753..2384538 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| C7M25_RS12170 (C7M25_02441) | sinR | 2384586..2384921 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| C7M25_RS12175 (C7M25_02442) | sinI | 2384955..2385128 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| C7M25_RS12180 (C7M25_02443) | - | 2385305..2386099 (-) | 795 | WP_076424968.1 | YqhG family protein | - |
| C7M25_RS12185 (C7M25_02444) | - | 2386121..2387791 (-) | 1671 | WP_124934996.1 | DEAD/DEAH box helicase | - |
| C7M25_RS12190 (C7M25_02445) | gcvT | 2388215..2389315 (+) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=283040 C7M25_RS12175 WP_003153105.1 2384955..2385128(-) (sinI) [Bacillus velezensis strain SRCM102747]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=283040 C7M25_RS12175 WP_003153105.1 2384955..2385128(-) (sinI) [Bacillus velezensis strain SRCM102747]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |