Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   C7M24_RS12505 Genome accession   NZ_CP028210
Coordinates   2608050..2608316 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM102746     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2603050..2613316
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M24_RS12455 (C7M24_02508) sinR 2603214..2603549 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C7M24_RS12460 (C7M24_02509) tasA 2603597..2604382 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  C7M24_RS12465 (C7M24_02510) sipW 2604447..2605031 (-) 585 WP_160223172.1 signal peptidase I SipW -
  C7M24_RS12470 (C7M24_02511) tapA 2605003..2605674 (-) 672 WP_160223173.1 amyloid fiber anchoring/assembly protein TapA -
  C7M24_RS12475 (C7M24_02512) - 2605933..2606262 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  C7M24_RS12480 (C7M24_02513) - 2606302..2606481 (-) 180 WP_160223174.1 YqzE family protein -
  C7M24_RS12485 (C7M24_02514) comGG 2606538..2606915 (-) 378 WP_160223175.1 competence type IV pilus minor pilin ComGG Machinery gene
  C7M24_RS12490 (C7M24_02515) comGF 2606916..2607416 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  C7M24_RS12495 (C7M24_02516) comGE 2607325..2607639 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  C7M24_RS12500 (C7M24_02517) comGD 2607623..2608060 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  C7M24_RS12505 (C7M24_02518) comGC 2608050..2608316 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  C7M24_RS12510 (C7M24_02519) comGB 2608363..2609400 (-) 1038 WP_061582071.1 competence type IV pilus assembly protein ComGB Machinery gene
  C7M24_RS12515 (C7M24_02520) comGA 2609387..2610457 (-) 1071 WP_043020785.1 competence type IV pilus ATPase ComGA Machinery gene
  C7M24_RS12520 (C7M24_02521) - 2610654..2611604 (-) 951 WP_160223176.1 magnesium transporter CorA family protein -
  C7M24_RS12525 (C7M24_02522) - 2611750..2613051 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=282963 C7M24_RS12505 WP_042635730.1 2608050..2608316(-) (comGC) [Bacillus velezensis strain SRCM102746]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=282963 C7M24_RS12505 WP_042635730.1 2608050..2608316(-) (comGC) [Bacillus velezensis strain SRCM102746]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAGGGCTGTGAAGGACTGCAGAATATGGTGAAAGCTCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAAAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602

Multiple sequence alignment