Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C7M22_RS02470 Genome accession   NZ_CP028208
Coordinates   474510..474650 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM102744     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 469510..479650
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M22_RS02445 (C7M22_00492) - 469850..470233 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  C7M22_RS02450 (C7M22_00493) comA 470255..470899 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  C7M22_RS02455 (C7M22_00494) comP 470980..473271 (-) 2292 WP_160223246.1 histidine kinase Regulator
  C7M22_RS02460 (C7M22_00495) comX 473283..473447 (-) 165 WP_061581461.1 competence pheromone ComX -
  C7M22_RS02465 (C7M22_00496) - 473447..474358 (-) 912 WP_081111611.1 polyprenyl synthetase family protein -
  C7M22_RS02470 (C7M22_00497) degQ 474510..474650 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  C7M22_RS02475 (C7M22_00498) - 475115..475456 (+) 342 WP_069006914.1 hypothetical protein -
  C7M22_RS02480 (C7M22_00499) - 475463..476686 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  C7M22_RS02485 (C7M22_00500) - 476816..478282 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  C7M22_RS02490 (C7M22_00501) - 478300..478851 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  C7M22_RS02495 (C7M22_00502) - 478948..479346 (-) 399 WP_015240486.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=282771 C7M22_RS02470 WP_003152043.1 474510..474650(-) (degQ) [Bacillus velezensis strain SRCM102744]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=282771 C7M22_RS02470 WP_003152043.1 474510..474650(-) (degQ) [Bacillus velezensis strain SRCM102744]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment