Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   C7M20_RS11975 Genome accession   NZ_CP028206
Coordinates   2493824..2494261 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM102742     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2488824..2499261
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M20_RS11925 (C7M20_02414) sinI 2489208..2489381 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  C7M20_RS11930 (C7M20_02415) sinR 2489415..2489750 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C7M20_RS11935 (C7M20_02416) tasA 2489798..2490583 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  C7M20_RS11940 (C7M20_02417) sipW 2490648..2491232 (-) 585 WP_160223172.1 signal peptidase I SipW -
  C7M20_RS11945 (C7M20_02418) tapA 2491204..2491875 (-) 672 WP_160223173.1 amyloid fiber anchoring/assembly protein TapA -
  C7M20_RS11950 (C7M20_02419) - 2492134..2492463 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  C7M20_RS11955 (C7M20_02420) - 2492503..2492682 (-) 180 WP_160223174.1 YqzE family protein -
  C7M20_RS11960 (C7M20_02421) comGG 2492739..2493116 (-) 378 WP_160223175.1 competence type IV pilus minor pilin ComGG Machinery gene
  C7M20_RS11965 (C7M20_02422) comGF 2493117..2493617 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  C7M20_RS11970 (C7M20_02423) comGE 2493526..2493840 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  C7M20_RS11975 (C7M20_02424) comGD 2493824..2494261 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  C7M20_RS11980 (C7M20_02425) comGC 2494251..2494559 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  C7M20_RS11985 (C7M20_02426) comGB 2494564..2495601 (-) 1038 WP_061582071.1 competence type IV pilus assembly protein ComGB Machinery gene
  C7M20_RS11990 (C7M20_02427) comGA 2495588..2496658 (-) 1071 WP_043020785.1 competence type IV pilus ATPase ComGA Machinery gene
  C7M20_RS11995 (C7M20_02428) - 2496855..2497805 (-) 951 WP_160223176.1 magnesium transporter CorA family protein -
  C7M20_RS12000 (C7M20_02429) - 2497951..2499252 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=282650 C7M20_RS11975 WP_012117983.1 2493824..2494261(-) (comGD) [Bacillus velezensis strain SRCM102742]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=282650 C7M20_RS11975 WP_012117983.1 2493824..2494261(-) (comGD) [Bacillus velezensis strain SRCM102742]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTTCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572


Multiple sequence alignment