Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | C7M20_RS11925 | Genome accession | NZ_CP028206 |
| Coordinates | 2489208..2489381 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SRCM102742 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2484208..2494381
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7M20_RS11910 (C7M20_02411) | gcvT | 2485021..2486121 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| C7M20_RS11915 (C7M20_02412) | - | 2486545..2488215 (+) | 1671 | WP_124934996.1 | DEAD/DEAH box helicase | - |
| C7M20_RS11920 (C7M20_02413) | - | 2488237..2489031 (+) | 795 | WP_076424968.1 | YqhG family protein | - |
| C7M20_RS11925 (C7M20_02414) | sinI | 2489208..2489381 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| C7M20_RS11930 (C7M20_02415) | sinR | 2489415..2489750 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| C7M20_RS11935 (C7M20_02416) | tasA | 2489798..2490583 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| C7M20_RS11940 (C7M20_02417) | sipW | 2490648..2491232 (-) | 585 | WP_160223172.1 | signal peptidase I SipW | - |
| C7M20_RS11945 (C7M20_02418) | tapA | 2491204..2491875 (-) | 672 | WP_160223173.1 | amyloid fiber anchoring/assembly protein TapA | - |
| C7M20_RS11950 (C7M20_02419) | - | 2492134..2492463 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| C7M20_RS11955 (C7M20_02420) | - | 2492503..2492682 (-) | 180 | WP_160223174.1 | YqzE family protein | - |
| C7M20_RS11960 (C7M20_02421) | comGG | 2492739..2493116 (-) | 378 | WP_160223175.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| C7M20_RS11965 (C7M20_02422) | comGF | 2493117..2493617 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| C7M20_RS11970 (C7M20_02423) | comGE | 2493526..2493840 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| C7M20_RS11975 (C7M20_02424) | comGD | 2493824..2494261 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=282647 C7M20_RS11925 WP_003153105.1 2489208..2489381(+) (sinI) [Bacillus velezensis strain SRCM102742]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=282647 C7M20_RS11925 WP_003153105.1 2489208..2489381(+) (sinI) [Bacillus velezensis strain SRCM102742]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |