Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | C7M18_RS19110 | Genome accession | NZ_CP028204 |
| Coordinates | 3937656..3937829 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain SRCM102755 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3932656..3942829
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7M18_RS19095 (C7M18_03845) | gcvT | 3933469..3934569 (-) | 1101 | WP_061890721.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| C7M18_RS19100 (C7M18_03846) | - | 3934993..3936663 (+) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| C7M18_RS19105 (C7M18_03847) | - | 3936685..3937479 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| C7M18_RS19110 (C7M18_03848) | sinI | 3937656..3937829 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| C7M18_RS19115 (C7M18_03849) | sinR | 3937863..3938198 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| C7M18_RS19120 (C7M18_03850) | tasA | 3938246..3939031 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| C7M18_RS19125 (C7M18_03851) | sipW | 3939096..3939680 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| C7M18_RS19130 (C7M18_03852) | tapA | 3939652..3940323 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| C7M18_RS19135 (C7M18_03853) | - | 3940582..3940911 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| C7M18_RS19140 (C7M18_03854) | - | 3940952..3941131 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| C7M18_RS19145 (C7M18_03855) | comGG | 3941188..3941565 (-) | 378 | WP_025649851.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| C7M18_RS19150 (C7M18_03856) | comGF | 3941566..3941961 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| C7M18_RS19155 (C7M18_03857) | comGE | 3941975..3942289 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| C7M18_RS19160 (C7M18_03858) | comGD | 3942273..3942710 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=282522 C7M18_RS19110 WP_014418369.1 3937656..3937829(+) (sinI) [Bacillus velezensis strain SRCM102755]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=282522 C7M18_RS19110 WP_014418369.1 3937656..3937829(+) (sinI) [Bacillus velezensis strain SRCM102755]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |