Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   C7M18_RS19110 Genome accession   NZ_CP028204
Coordinates   3937656..3937829 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain SRCM102755     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3932656..3942829
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M18_RS19095 (C7M18_03845) gcvT 3933469..3934569 (-) 1101 WP_061890721.1 glycine cleavage system aminomethyltransferase GcvT -
  C7M18_RS19100 (C7M18_03846) - 3934993..3936663 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  C7M18_RS19105 (C7M18_03847) - 3936685..3937479 (+) 795 WP_014418368.1 YqhG family protein -
  C7M18_RS19110 (C7M18_03848) sinI 3937656..3937829 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  C7M18_RS19115 (C7M18_03849) sinR 3937863..3938198 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C7M18_RS19120 (C7M18_03850) tasA 3938246..3939031 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  C7M18_RS19125 (C7M18_03851) sipW 3939096..3939680 (-) 585 WP_012117977.1 signal peptidase I SipW -
  C7M18_RS19130 (C7M18_03852) tapA 3939652..3940323 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  C7M18_RS19135 (C7M18_03853) - 3940582..3940911 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  C7M18_RS19140 (C7M18_03854) - 3940952..3941131 (-) 180 WP_003153093.1 YqzE family protein -
  C7M18_RS19145 (C7M18_03855) comGG 3941188..3941565 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  C7M18_RS19150 (C7M18_03856) comGF 3941566..3941961 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  C7M18_RS19155 (C7M18_03857) comGE 3941975..3942289 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  C7M18_RS19160 (C7M18_03858) comGD 3942273..3942710 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=282522 C7M18_RS19110 WP_014418369.1 3937656..3937829(+) (sinI) [Bacillus velezensis strain SRCM102755]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=282522 C7M18_RS19110 WP_014418369.1 3937656..3937829(+) (sinI) [Bacillus velezensis strain SRCM102755]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment