Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   C7M18_RS19155 Genome accession   NZ_CP028204
Coordinates   3941975..3942289 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain SRCM102755     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3936975..3947289
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M18_RS19110 (C7M18_03848) sinI 3937656..3937829 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  C7M18_RS19115 (C7M18_03849) sinR 3937863..3938198 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C7M18_RS19120 (C7M18_03850) tasA 3938246..3939031 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  C7M18_RS19125 (C7M18_03851) sipW 3939096..3939680 (-) 585 WP_012117977.1 signal peptidase I SipW -
  C7M18_RS19130 (C7M18_03852) tapA 3939652..3940323 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  C7M18_RS19135 (C7M18_03853) - 3940582..3940911 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  C7M18_RS19140 (C7M18_03854) - 3940952..3941131 (-) 180 WP_003153093.1 YqzE family protein -
  C7M18_RS19145 (C7M18_03855) comGG 3941188..3941565 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  C7M18_RS19150 (C7M18_03856) comGF 3941566..3941961 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  C7M18_RS19155 (C7M18_03857) comGE 3941975..3942289 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  C7M18_RS19160 (C7M18_03858) comGD 3942273..3942710 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  C7M18_RS19165 (C7M18_03859) comGC 3942700..3943008 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  C7M18_RS19170 (C7M18_03860) comGB 3943013..3944050 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  C7M18_RS19175 (C7M18_03861) comGA 3944037..3945107 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  C7M18_RS19180 (C7M18_03862) - 3945300..3946250 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=282525 C7M18_RS19155 WP_017418140.1 3941975..3942289(-) (comGE) [Bacillus velezensis strain SRCM102755]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=282525 C7M18_RS19155 WP_017418140.1 3941975..3942289(-) (comGE) [Bacillus velezensis strain SRCM102755]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment