Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C7M18_RS02410 Genome accession   NZ_CP028204
Coordinates   467219..467359 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM102755     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 462219..472359
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M18_RS02390 (C7M18_00478) - 462516..462899 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  C7M18_RS02395 (C7M18_00479) comA 462921..463565 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  C7M18_RS02400 (C7M18_00480) comP 463646..465949 (-) 2304 WP_160216563.1 histidine kinase Regulator
  C7M18_RS02405 (C7M18_00481) comQ 466075..467034 (-) 960 WP_233662477.1 class 1 isoprenoid biosynthesis enzyme Regulator
  C7M18_RS02410 (C7M18_00482) degQ 467219..467359 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  C7M18_RS02415 (C7M18_00483) - 467825..468166 (+) 342 WP_015418107.1 hypothetical protein -
  C7M18_RS02420 (C7M18_00484) - 468173..469396 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  C7M18_RS02425 (C7M18_00485) - 469526..470992 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  C7M18_RS02430 (C7M18_00486) - 471010..471561 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  C7M18_RS02435 (C7M18_00487) - 471658..472056 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=282469 C7M18_RS02410 WP_003152043.1 467219..467359(-) (degQ) [Bacillus velezensis strain SRCM102755]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=282469 C7M18_RS02410 WP_003152043.1 467219..467359(-) (degQ) [Bacillus velezensis strain SRCM102755]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment