Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   C7M17_RS20580 Genome accession   NZ_CP028202
Coordinates   3958457..3958597 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM102754     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3953457..3963597
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M17_RS20550 (C7M17_04057) yueI 3953751..3954149 (+) 399 WP_088467369.1 YueI family protein -
  C7M17_RS20555 (C7M17_04058) pncA 3954246..3954797 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  C7M17_RS20560 (C7M17_04059) pncB 3954813..3956285 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C7M17_RS20565 (C7M17_04060) pdeH 3956422..3957651 (+) 1230 WP_014477835.1 cyclic di-GMP phosphodiesterase -
  C7M17_RS20570 (C7M17_04061) - 3957627..3957995 (-) 369 WP_014477834.1 hypothetical protein -
  C7M17_RS20575 - 3958110..3958235 (-) 126 WP_141770195.1 hypothetical protein -
  C7M17_RS20580 (C7M17_04062) degQ 3958457..3958597 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C7M17_RS20585 (C7M17_04063) - 3958782..3959651 (+) 870 WP_015714626.1 polyprenyl synthetase family protein -
  C7M17_RS20590 (C7M17_04064) comX 3959648..3959869 (+) 222 WP_014114983.1 competence pheromone ComX -
  C7M17_RS20595 (C7M17_04065) comP 3959885..3962197 (+) 2313 WP_068947635.1 histidine kinase Regulator
  C7M17_RS20600 (C7M17_04066) comA 3962278..3962922 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C7M17_RS20605 (C7M17_04067) yuxO 3962941..3963321 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=282451 C7M17_RS20580 WP_003220708.1 3958457..3958597(+) (degQ) [Bacillus subtilis strain SRCM102754]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=282451 C7M17_RS20580 WP_003220708.1 3958457..3958597(+) (degQ) [Bacillus subtilis strain SRCM102754]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment