Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   C7M17_RS02490 Genome accession   NZ_CP028202
Coordinates   431934..432107 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM102754     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 426934..437107
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M17_RS02445 (C7M17_00473) comGE 427285..427632 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  C7M17_RS02450 comGF 427658..428041 (+) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  C7M17_RS02455 (C7M17_00475) comGG 428042..428416 (+) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  C7M17_RS02460 (C7M17_00476) spoIITA 428487..428666 (+) 180 WP_003230176.1 YqzE family protein -
  C7M17_RS02465 (C7M17_00477) yqzG 428708..429034 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  C7M17_RS02470 (C7M17_00478) tapA 429306..430067 (+) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  C7M17_RS02475 (C7M17_00479) sipW 430051..430623 (+) 573 WP_003230181.1 signal peptidase I SipW -
  C7M17_RS02480 (C7M17_00480) tasA 430687..431472 (+) 786 WP_014664586.1 biofilm matrix protein TasA -
  C7M17_RS02485 (C7M17_00481) sinR 431565..431900 (-) 336 WP_160245081.1 transcriptional regulator SinR Regulator
  C7M17_RS02490 (C7M17_00482) sinI 431934..432107 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  C7M17_RS02495 (C7M17_00483) yqhG 432290..433084 (-) 795 WP_003230200.1 YqhG family protein -
  C7M17_RS02500 (C7M17_00484) hepAA 433105..434778 (-) 1674 WP_029726726.1 SNF2-related protein -
  C7M17_RS02505 (C7M17_00485) gcvT 435220..436308 (+) 1089 WP_160245082.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=282396 C7M17_RS02490 WP_003230187.1 431934..432107(-) (sinI) [Bacillus subtilis strain SRCM102754]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=282396 C7M17_RS02490 WP_003230187.1 431934..432107(-) (sinI) [Bacillus subtilis strain SRCM102754]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment