Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D9C18_RS19500 | Genome accession | NZ_CP032865 |
| Coordinates | 3652759..3652932 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis strain N3-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3647759..3657932
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9C18_RS19455 (D9C18_19455) | comGE | 3648110..3648457 (+) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
| D9C18_RS19460 (D9C18_19460) | comGF | 3648483..3648866 (+) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| D9C18_RS19465 (D9C18_19465) | comGG | 3648867..3649241 (+) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| D9C18_RS19470 (D9C18_19470) | spoIITA | 3649312..3649491 (+) | 180 | WP_014480252.1 | YqzE family protein | - |
| D9C18_RS19475 (D9C18_19475) | yqzG | 3649533..3649859 (-) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| D9C18_RS19480 (D9C18_19480) | tapA | 3650131..3650892 (+) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D9C18_RS19485 (D9C18_19485) | sipW | 3650876..3651448 (+) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| D9C18_RS19490 (D9C18_19490) | tasA | 3651512..3652297 (+) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| D9C18_RS19495 (D9C18_19495) | sinR | 3652390..3652725 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| D9C18_RS19500 (D9C18_19500) | sinI | 3652759..3652932 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| D9C18_RS19505 (D9C18_19505) | yqhG | 3653115..3653909 (-) | 795 | WP_014480249.1 | YqhG family protein | - |
| D9C18_RS19510 (D9C18_19510) | hepAA | 3653930..3655603 (-) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| D9C18_RS19515 (D9C18_19515) | gcvT | 3656045..3657133 (+) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=279996 D9C18_RS19500 WP_003230187.1 3652759..3652932(-) (sinI) [Bacillus subtilis subsp. subtilis strain N3-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=279996 D9C18_RS19500 WP_003230187.1 3652759..3652932(-) (sinI) [Bacillus subtilis subsp. subtilis strain N3-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |