Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   D9C14_RS21440 Genome accession   NZ_CP032860
Coordinates   4080393..4080776 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain SSJ-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 4075393..4085776
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C14_RS21400 (D9C14_21400) sinI 4076326..4076499 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C14_RS21405 (D9C14_21405) sinR 4076533..4076868 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C14_RS21410 (D9C14_21410) tasA 4076961..4077746 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  D9C14_RS21415 (D9C14_21415) sipW 4077810..4078382 (-) 573 WP_072692741.1 signal peptidase I SipW -
  D9C14_RS21420 (D9C14_21420) tapA 4078366..4079127 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  D9C14_RS21425 (D9C14_21425) yqzG 4079399..4079725 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C14_RS21430 (D9C14_21430) spoIITA 4079767..4079946 (-) 180 WP_029726723.1 YqzE family protein -
  D9C14_RS21435 (D9C14_21435) comGG 4080018..4080392 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  D9C14_RS21440 (D9C14_21440) comGF 4080393..4080776 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  D9C14_RS21445 (D9C14_21445) comGE 4080802..4081149 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  D9C14_RS21450 (D9C14_21450) comGD 4081133..4081564 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  D9C14_RS21455 (D9C14_21455) comGC 4081554..4081850 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  D9C14_RS21460 (D9C14_21460) comGB 4081864..4082901 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  D9C14_RS21465 (D9C14_21465) comGA 4082888..4083958 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  D9C14_RS21470 (D9C14_21470) - 4084171..4084368 (-) 198 WP_029726717.1 hypothetical protein -
  D9C14_RS21475 (D9C14_21475) corA 4084370..4085323 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=279549 D9C14_RS21440 WP_029726721.1 4080393..4080776(-) (comGF) [Bacillus subtilis subsp. subtilis strain SSJ-1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=279549 D9C14_RS21440 WP_029726721.1 4080393..4080776(-) (comGF) [Bacillus subtilis subsp. subtilis strain SSJ-1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969