Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D9C14_RS21400 | Genome accession | NZ_CP032860 |
| Coordinates | 4076326..4076499 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis strain SSJ-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 4071326..4081499
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9C14_RS21385 (D9C14_21385) | gcvT | 4072126..4073214 (-) | 1089 | WP_015714248.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D9C14_RS21390 (D9C14_21390) | hepAA | 4073655..4075328 (+) | 1674 | WP_029726726.1 | SNF2-related protein | - |
| D9C14_RS21395 (D9C14_21395) | yqhG | 4075349..4076143 (+) | 795 | WP_015714249.1 | YqhG family protein | - |
| D9C14_RS21400 (D9C14_21400) | sinI | 4076326..4076499 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| D9C14_RS21405 (D9C14_21405) | sinR | 4076533..4076868 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| D9C14_RS21410 (D9C14_21410) | tasA | 4076961..4077746 (-) | 786 | WP_014664586.1 | biofilm matrix protein TasA | - |
| D9C14_RS21415 (D9C14_21415) | sipW | 4077810..4078382 (-) | 573 | WP_072692741.1 | signal peptidase I SipW | - |
| D9C14_RS21420 (D9C14_21420) | tapA | 4078366..4079127 (-) | 762 | WP_029726724.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D9C14_RS21425 (D9C14_21425) | yqzG | 4079399..4079725 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| D9C14_RS21430 (D9C14_21430) | spoIITA | 4079767..4079946 (-) | 180 | WP_029726723.1 | YqzE family protein | - |
| D9C14_RS21435 (D9C14_21435) | comGG | 4080018..4080392 (-) | 375 | WP_029726722.1 | ComG operon protein ComGG | Machinery gene |
| D9C14_RS21440 (D9C14_21440) | comGF | 4080393..4080776 (-) | 384 | WP_029726721.1 | ComG operon protein ComGF | Machinery gene |
| D9C14_RS21445 (D9C14_21445) | comGE | 4080802..4081149 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=279546 D9C14_RS21400 WP_003230187.1 4076326..4076499(+) (sinI) [Bacillus subtilis subsp. subtilis strain SSJ-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=279546 D9C14_RS21400 WP_003230187.1 4076326..4076499(+) (sinI) [Bacillus subtilis subsp. subtilis strain SSJ-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |