Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   D9C12_RS14655 Genome accession   NZ_CP032857
Coordinates   2725431..2725814 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain 2RL2-3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2720431..2730814
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C12_RS14615 (D9C12_14615) sinI 2721365..2721538 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C12_RS14620 (D9C12_14620) sinR 2721572..2721907 (+) 336 WP_121509422.1 transcriptional regulator SinR Regulator
  D9C12_RS14625 (D9C12_14625) tasA 2722000..2722785 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C12_RS14630 (D9C12_14630) sipW 2722849..2723421 (-) 573 WP_003230181.1 signal peptidase I SipW -
  D9C12_RS14635 (D9C12_14635) tapA 2723405..2724166 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C12_RS14640 (D9C12_14640) yqzG 2724438..2724764 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C12_RS14645 (D9C12_14645) spoIITA 2724806..2724985 (-) 180 WP_014480252.1 YqzE family protein -
  D9C12_RS14650 (D9C12_14650) comGG 2725056..2725430 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C12_RS14655 (D9C12_14655) comGF 2725431..2725814 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  D9C12_RS14660 (D9C12_14660) comGE 2725840..2726187 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  D9C12_RS14665 (D9C12_14665) comGD 2726171..2726602 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  D9C12_RS14670 (D9C12_14670) comGC 2726592..2726888 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  D9C12_RS14675 (D9C12_14675) comGB 2726902..2727939 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  D9C12_RS14680 (D9C12_14680) comGA 2727926..2728996 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  D9C12_RS14685 (D9C12_14685) - 2729208..2729405 (-) 198 WP_014480259.1 CBS domain-containing protein -
  D9C12_RS14690 (D9C12_14690) corA 2729407..2730360 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=279359 D9C12_RS14655 WP_029317913.1 2725431..2725814(-) (comGF) [Bacillus subtilis subsp. subtilis strain 2RL2-3]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=279359 D9C12_RS14655 WP_029317913.1 2725431..2725814(-) (comGF) [Bacillus subtilis subsp. subtilis strain 2RL2-3]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976