Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   D9C09_RS20395 Genome accession   NZ_CP032852
Coordinates   3819274..3819414 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain GFR-12     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3814274..3824414
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C09_RS20370 (D9C09_20370) yuxO 3814551..3814931 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  D9C09_RS20375 (D9C09_20375) comA 3814950..3815594 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D9C09_RS20380 (D9C09_20380) comP 3815675..3817987 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  D9C09_RS20385 (D9C09_20385) comX 3818003..3818224 (-) 222 WP_014480704.1 competence pheromone ComX -
  D9C09_RS20390 (D9C09_20390) comQ 3818226..3819089 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  D9C09_RS20395 (D9C09_20395) degQ 3819274..3819414 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D9C09_RS20400 (D9C09_20400) - 3819636..3819761 (+) 126 WP_003228793.1 hypothetical protein -
  D9C09_RS20405 (D9C09_20405) - 3819876..3820244 (+) 369 WP_046381300.1 hypothetical protein -
  D9C09_RS20410 (D9C09_20410) pdeH 3820220..3821449 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  D9C09_RS20415 (D9C09_20415) pncB 3821585..3823057 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  D9C09_RS20420 (D9C09_20420) pncA 3823073..3823624 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  D9C09_RS20425 (D9C09_20425) yueI 3823721..3824119 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=278960 D9C09_RS20395 WP_003220708.1 3819274..3819414(-) (degQ) [Bacillus subtilis subsp. subtilis strain GFR-12]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=278960 D9C09_RS20395 WP_003220708.1 3819274..3819414(-) (degQ) [Bacillus subtilis subsp. subtilis strain GFR-12]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1