Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   C6N67_RS00075 Genome accession   NZ_CP027427
Coordinates   5866..6357 (+) Length   163 a.a.
NCBI ID   WP_106443629.1    Uniprot ID   -
Organism   Weissella cibaria strain BM2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 712..42896 5866..6357 within 0


Gene organization within MGE regions


Location: 712..42896
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C6N67_RS00015 (C6N67_00015) - 712..1215 (-) 504 WP_060654532.1 Ltp family lipoprotein -
  C6N67_RS00020 (C6N67_00020) - 1286..1684 (-) 399 WP_060654534.1 hypothetical protein -
  C6N67_RS00025 (C6N67_00025) - 1688..2056 (-) 369 WP_106443619.1 helix-turn-helix domain-containing protein -
  C6N67_RS00030 (C6N67_00030) - 2339..2554 (+) 216 WP_106443620.1 hypothetical protein -
  C6N67_RS00035 (C6N67_00035) - 2557..3279 (+) 723 WP_106443621.1 ORF6C domain-containing protein -
  C6N67_RS00040 (C6N67_00040) - 3282..3569 (+) 288 WP_106443622.1 hypothetical protein -
  C6N67_RS00045 (C6N67_00045) - 3566..3763 (+) 198 WP_106443623.1 hypothetical protein -
  C6N67_RS00050 (C6N67_00050) - 3760..3948 (+) 189 WP_106443624.1 hypothetical protein -
  C6N67_RS11820 - 4229..4372 (+) 144 WP_173906489.1 hypothetical protein -
  C6N67_RS00060 (C6N67_00060) - 4365..4547 (+) 183 WP_106443626.1 hypothetical protein -
  C6N67_RS00065 (C6N67_00065) - 4549..5190 (+) 642 WP_106443627.1 ERF family protein -
  C6N67_RS00070 (C6N67_00070) - 5190..5900 (+) 711 WP_106443628.1 putative HNHc nuclease -
  C6N67_RS00075 (C6N67_00075) ssb 5866..6357 (+) 492 WP_106443629.1 single-stranded DNA-binding protein Machinery gene
  C6N67_RS00080 (C6N67_00080) - 6368..6697 (+) 330 WP_106443630.1 helix-turn-helix domain-containing protein -
  C6N67_RS00085 (C6N67_00085) - 6839..7366 (+) 528 WP_106443631.1 hypothetical protein -
  C6N67_RS00090 (C6N67_00090) - 7381..7893 (+) 513 WP_106443632.1 hypothetical protein -
  C6N67_RS00095 (C6N67_00095) - 7942..8559 (+) 618 WP_106443633.1 hypothetical protein -
  C6N67_RS11695 - 8609..8776 (+) 168 WP_158701279.1 hypothetical protein -
  C6N67_RS00100 (C6N67_00100) - 8846..9034 (+) 189 WP_003610538.1 hypothetical protein -
  C6N67_RS00105 (C6N67_00105) - 9118..9531 (+) 414 WP_106443634.1 ArpU family phage packaging/lysis transcriptional regulator -
  C6N67_RS00110 (C6N67_00110) - 9711..11021 (+) 1311 WP_106443635.1 hypothetical protein -
  C6N67_RS12205 - 11473..11604 (+) 132 WP_278284361.1 hypothetical protein -
  C6N67_RS00115 (C6N67_00115) - 11621..12193 (+) 573 WP_158701280.1 hypothetical protein -
  C6N67_RS00120 (C6N67_00120) - 12288..12938 (+) 651 WP_106443637.1 hypothetical protein -
  C6N67_RS00125 (C6N67_00125) - 12962..13384 (+) 423 WP_106443638.1 terminase small subunit -
  C6N67_RS00130 (C6N67_00130) - 13377..14657 (+) 1281 WP_106443639.1 PBSX family phage terminase large subunit -
  C6N67_RS00135 (C6N67_00135) - 14666..16213 (+) 1548 WP_106443640.1 phage portal protein -
  C6N67_RS00140 (C6N67_00140) - 16200..17135 (+) 936 WP_106443641.1 minor capsid protein -
  C6N67_RS00145 (C6N67_00145) - 17253..17828 (+) 576 WP_106443642.1 DUF4355 domain-containing protein -
  C6N67_RS00150 (C6N67_00150) - 17846..18748 (+) 903 WP_106443643.1 phage capsid protein -
  C6N67_RS00155 (C6N67_00155) - 18767..19105 (+) 339 WP_106443644.1 hypothetical protein -
  C6N67_RS00160 (C6N67_00160) - 19117..19458 (+) 342 WP_106443645.1 phage head-tail connector protein -
  C6N67_RS00165 (C6N67_00165) - 19458..19742 (+) 285 WP_106443646.1 hypothetical protein -
  C6N67_RS00170 (C6N67_00170) - 19745..20107 (+) 363 WP_060654728.1 HK97-gp10 family putative phage morphogenesis protein -
  C6N67_RS00175 (C6N67_00175) - 20104..20472 (+) 369 WP_106443647.1 hypothetical protein -
  C6N67_RS00180 (C6N67_00180) - 20481..21095 (+) 615 WP_106443648.1 phage major tail protein, TP901-1 family -
  C6N67_RS00185 (C6N67_00185) - 21180..21626 (+) 447 WP_106443649.1 tail assembly chaperone -
  C6N67_RS00190 (C6N67_00190) - 21719..21925 (+) 207 WP_106443650.1 hypothetical protein -
  C6N67_RS00195 (C6N67_00195) - 21942..25076 (+) 3135 WP_106443651.1 phage tail tape measure protein -
  C6N67_RS00200 (C6N67_00200) - 25086..25982 (+) 897 WP_106443652.1 phage tail domain-containing protein -
  C6N67_RS00205 (C6N67_00205) - 25992..28880 (+) 2889 WP_106443653.1 phage tail protein -
  C6N67_RS11825 - 28895..29062 (+) 168 WP_173906490.1 hypothetical protein -
  C6N67_RS00210 (C6N67_00210) - 29055..29303 (+) 249 WP_106443654.1 hypothetical protein -
  C6N67_RS00215 (C6N67_00215) - 29316..29546 (+) 231 WP_043708832.1 hypothetical protein -
  C6N67_RS00220 (C6N67_00220) - 29533..29853 (+) 321 WP_106443655.1 phage holin, LLH family -
  C6N67_RS00225 (C6N67_00225) - 29855..30874 (+) 1020 WP_106443656.1 GH25 family lysozyme -
  C6N67_RS00230 (C6N67_00230) - 31286..32242 (+) 957 WP_106443657.1 TerC family protein -
  C6N67_RS00235 (C6N67_00235) - 32372..33175 (+) 804 WP_010372845.1 SPFH domain-containing protein -
  C6N67_RS00240 (C6N67_00240) - 33346..34014 (-) 669 WP_106443658.1 histidine phosphatase family protein -
  C6N67_RS00245 (C6N67_00245) rimM 34175..34678 (+) 504 WP_010372854.1 ribosome maturation factor RimM -
  C6N67_RS00250 (C6N67_00250) trmD 34681..35421 (+) 741 WP_043708158.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  C6N67_RS00255 (C6N67_00255) rplS 35539..35895 (+) 357 WP_010372859.1 50S ribosomal protein L19 -
  C6N67_RS00260 (C6N67_00260) - 36092..37378 (+) 1287 WP_106443659.1 cation:dicarboxylase symporter family transporter -
  C6N67_RS00265 (C6N67_00265) - 37593..38549 (+) 957 WP_106443660.1 YitT family protein -
  C6N67_RS00270 (C6N67_00270) - 38574..38759 (+) 186 WP_003609051.1 2-hydroxymuconate tautomerase -
  C6N67_RS00275 (C6N67_00275) glpK 38858..40363 (+) 1506 WP_106443661.1 glycerol kinase GlpK -
  C6N67_RS00280 (C6N67_00280) - 40750..42198 (+) 1449 WP_106443662.1 C40 family peptidase -
  C6N67_RS00285 (C6N67_00285) - 42252..42896 (-) 645 WP_010372451.1 deoxynucleoside kinase -

Sequence

Protein


Download         Length: 163 a.a.        Molecular weight: 18043.75 Da        Isoelectric Point: 4.9371

>NTDB_id=277076 C6N67_RS00075 WP_106443629.1 5866..6357(+) (ssb) [Weissella cibaria strain BM2]
MNHVSLIGRLTKEPELRYTTSGAAVASGTIAVNRDFTNANGERESDFINFVIWRKAAENFVNMTAKGSQVGLEGSWQTRS
YENQQGQRVYVSELVVSNFTLVETKEQTEQRKGQSAQQGNGGFKSTPSQNNFNGQQAPQQGSFSPNDMYGKDLPPLNDDD
LPF

Nucleotide


Download         Length: 492 bp        

>NTDB_id=277076 C6N67_RS00075 WP_106443629.1 5866..6357(+) (ssb) [Weissella cibaria strain BM2]
ATGAATCACGTCTCGCTAATCGGTCGGCTCACTAAGGAACCAGAACTTAGGTACACCACGTCAGGTGCAGCAGTTGCATC
AGGAACAATCGCAGTTAACCGAGATTTTACGAACGCTAATGGGGAGCGTGAGAGTGACTTTATCAACTTTGTAATTTGGC
GCAAGGCTGCCGAAAACTTTGTCAATATGACCGCTAAGGGTTCACAGGTTGGCTTGGAAGGTTCGTGGCAAACACGAAGC
TATGAGAACCAACAAGGACAGCGTGTATACGTTTCTGAACTAGTAGTAAGTAACTTTACTTTAGTTGAAACAAAAGAGCA
GACAGAGCAACGCAAGGGGCAATCAGCACAACAAGGTAATGGTGGGTTCAAGAGTACACCATCACAAAACAACTTCAATG
GTCAGCAAGCACCACAGCAAGGGAGCTTCTCGCCTAATGATATGTACGGTAAAGACTTGCCGCCGTTGAACGATGATGAT
CTTCCATTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(1-100)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

53.801

100

0.564
  ssbA Bacillus subtilis subsp. subtilis str. 168

47.399

100

0.503
  ssb Vibrio cholerae strain A1552

35.593

100

0.387

Multiple sequence alignment