Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CEP79_RS03660 Genome accession   NZ_CP027404
Coordinates   741189..741302 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori strain FDAARGOS_300     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 736189..746302
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CEP79_RS03635 (CEP79_03635) - 736230..738458 (+) 2229 WP_000357196.1 ATP-dependent Clp protease ATP-binding subunit -
  CEP79_RS03640 (CEP79_03640) panD 738448..738801 (+) 354 WP_000142257.1 aspartate 1-decarboxylase -
  CEP79_RS03645 (CEP79_03645) - 738804..739106 (+) 303 WP_000347931.1 YbaB/EbfC family nucleoid-associated protein -
  CEP79_RS03650 (CEP79_03650) - 739106..740110 (+) 1005 WP_000468465.1 PDZ domain-containing protein -
  CEP79_RS03655 (CEP79_03655) comB6 740118..741173 (+) 1056 WP_000679725.1 P-type conjugative transfer protein TrbL Machinery gene
  CEP79_RS03660 (CEP79_03660) comB7 741189..741302 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  CEP79_RS03665 (CEP79_03665) comB8 741299..742042 (+) 744 WP_000660577.1 virB8 family protein Machinery gene
  CEP79_RS03670 (CEP79_03670) comB9 742042..743028 (+) 987 WP_001878684.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CEP79_RS03675 (CEP79_03675) comB10 743021..744151 (+) 1131 WP_001045766.1 DNA type IV secretion system protein ComB10 Machinery gene
  CEP79_RS03680 (CEP79_03680) - 744221..745633 (+) 1413 WP_000694964.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=276915 CEP79_RS03660 WP_001217877.1 741189..741302(+) (comB7) [Helicobacter pylori strain FDAARGOS_300]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=276915 CEP79_RS03660 WP_001217877.1 741189..741302(+) (comB7) [Helicobacter pylori strain FDAARGOS_300]
ATGAGGATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
TACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment