Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   D4K70_RS07390 Genome accession   NZ_CP032476
Coordinates   1492689..1492802 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain 381-C-EK1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1487689..1497802
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4K70_RS07370 - 1488358..1489770 (-) 1413 WP_139532720.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4K70_RS07375 comB10 1489840..1490976 (-) 1137 WP_139532722.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4K70_RS07380 comB9 1490969..1491955 (-) 987 WP_139532724.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4K70_RS07385 comB8 1491955..1492692 (-) 738 WP_139532725.1 virB8 family protein Machinery gene
  D4K70_RS07390 comB7 1492689..1492802 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4K70_RS07395 comB6 1492818..1493873 (-) 1056 WP_139532727.1 P-type conjugative transfer protein TrbL Machinery gene
  D4K70_RS07400 - 1493881..1494876 (-) 996 WP_139532911.1 PDZ domain-containing protein -
  D4K70_RS07405 - 1494876..1495169 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  D4K70_RS07410 panD 1495180..1495530 (-) 351 WP_000142242.1 aspartate 1-decarboxylase -
  D4K70_RS07415 - 1495520..1497745 (-) 2226 WP_139532729.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=276079 D4K70_RS07390 WP_001217873.1 1492689..1492802(-) (comB7) [Helicobacter pylori strain 381-C-EK1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=276079 D4K70_RS07390 WP_001217873.1 1492689..1492802(-) (comB7) [Helicobacter pylori strain 381-C-EK1]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment