Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C5695_RS15870 Genome accession   NZ_CP027116
Coordinates   3043969..3044109 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain 145     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3038969..3049109
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C5695_RS15845 (C5695_15915) - 3039235..3039624 (-) 390 WP_117731527.1 hotdog fold thioesterase -
  C5695_RS15850 (C5695_15920) comA 3039648..3040289 (-) 642 WP_117731528.1 response regulator transcription factor Regulator
  C5695_RS15855 (C5695_15925) comP 3040370..3042682 (-) 2313 WP_117731529.1 ATP-binding protein Regulator
  C5695_RS15860 (C5695_15930) comX 3042736..3042906 (-) 171 WP_117731530.1 competence pheromone ComX -
  C5695_RS15865 (C5695_15935) - 3042903..3043817 (-) 915 WP_117731531.1 polyprenyl synthetase family protein -
  C5695_RS15870 (C5695_15940) degQ 3043969..3044109 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  C5695_RS15875 (C5695_15945) - 3044615..3044968 (+) 354 WP_117731532.1 inner spore coat protein -
  C5695_RS15880 (C5695_15950) - 3045000..3046226 (-) 1227 WP_117731533.1 HDOD domain-containing protein -
  C5695_RS15885 (C5695_15955) - 3046367..3047836 (-) 1470 WP_117731534.1 nicotinate phosphoribosyltransferase -
  C5695_RS15890 (C5695_15960) - 3047854..3048405 (-) 552 WP_117731535.1 isochorismatase family cysteine hydrolase -
  C5695_RS15895 (C5695_15965) - 3048466..3048873 (-) 408 WP_117731536.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=275073 C5695_RS15870 WP_003213123.1 3043969..3044109(-) (degQ) [Bacillus pumilus strain 145]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=275073 C5695_RS15870 WP_003213123.1 3043969..3044109(-) (degQ) [Bacillus pumilus strain 145]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACAGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment