Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   C3Z10_RS13415 Genome accession   NZ_CP026610
Coordinates   2726444..2726821 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain CGMCC 11640     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2721444..2731821
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C3Z10_RS13375 (C3Z10_13375) - 2721942..2722736 (+) 795 WP_007408330.1 YqhG family protein -
  C3Z10_RS13380 (C3Z10_13380) sinI 2722913..2723086 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  C3Z10_RS13385 (C3Z10_13385) sinR 2723120..2723455 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C3Z10_RS13390 (C3Z10_13390) tasA 2723503..2724288 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  C3Z10_RS13395 (C3Z10_13395) sipW 2724353..2724937 (-) 585 WP_015240205.1 signal peptidase I SipW -
  C3Z10_RS13400 (C3Z10_13400) tapA 2724909..2725580 (-) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  C3Z10_RS13405 (C3Z10_13405) - 2725839..2726168 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  C3Z10_RS13410 (C3Z10_13410) - 2726208..2726387 (-) 180 WP_003153093.1 YqzE family protein -
  C3Z10_RS13415 (C3Z10_13415) comGG 2726444..2726821 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  C3Z10_RS13420 (C3Z10_13420) comGF 2726822..2727322 (-) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  C3Z10_RS13425 (C3Z10_13425) comGE 2727231..2727545 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  C3Z10_RS13430 (C3Z10_13430) comGD 2727529..2727966 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  C3Z10_RS13435 (C3Z10_13435) comGC 2727956..2728264 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  C3Z10_RS13440 (C3Z10_13440) comGB 2728269..2729306 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  C3Z10_RS13445 (C3Z10_13445) comGA 2729293..2730363 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  C3Z10_RS13450 (C3Z10_13450) - 2730556..2731506 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=270785 C3Z10_RS13415 WP_015417814.1 2726444..2726821(-) (comGG) [Bacillus velezensis strain CGMCC 11640]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=270785 C3Z10_RS13415 WP_015417814.1 2726444..2726821(-) (comGG) [Bacillus velezensis strain CGMCC 11640]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment