Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | C3Z10_RS13380 | Genome accession | NZ_CP026610 |
| Coordinates | 2722913..2723086 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain CGMCC 11640 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2717913..2728086
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C3Z10_RS13365 (C3Z10_13365) | gcvT | 2718726..2719826 (-) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| C3Z10_RS13370 (C3Z10_13370) | - | 2720250..2721920 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| C3Z10_RS13375 (C3Z10_13375) | - | 2721942..2722736 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| C3Z10_RS13380 (C3Z10_13380) | sinI | 2722913..2723086 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| C3Z10_RS13385 (C3Z10_13385) | sinR | 2723120..2723455 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| C3Z10_RS13390 (C3Z10_13390) | tasA | 2723503..2724288 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| C3Z10_RS13395 (C3Z10_13395) | sipW | 2724353..2724937 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| C3Z10_RS13400 (C3Z10_13400) | tapA | 2724909..2725580 (-) | 672 | WP_031378945.1 | amyloid fiber anchoring/assembly protein TapA | - |
| C3Z10_RS13405 (C3Z10_13405) | - | 2725839..2726168 (+) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| C3Z10_RS13410 (C3Z10_13410) | - | 2726208..2726387 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| C3Z10_RS13415 (C3Z10_13415) | comGG | 2726444..2726821 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| C3Z10_RS13420 (C3Z10_13420) | comGF | 2726822..2727322 (-) | 501 | WP_257738552.1 | competence type IV pilus minor pilin ComGF | - |
| C3Z10_RS13425 (C3Z10_13425) | comGE | 2727231..2727545 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| C3Z10_RS13430 (C3Z10_13430) | comGD | 2727529..2727966 (-) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=270783 C3Z10_RS13380 WP_003153105.1 2722913..2723086(+) (sinI) [Bacillus velezensis strain CGMCC 11640]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=270783 C3Z10_RS13380 WP_003153105.1 2722913..2723086(+) (sinI) [Bacillus velezensis strain CGMCC 11640]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |