Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BV11031_RS05610 Genome accession   NZ_CP026362
Coordinates   1029868..1030251 (+) Length   127 a.a.
NCBI ID   WP_026014434.1    Uniprot ID   -
Organism   Bacillus vallismortis strain DSM 11031     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1024868..1035251
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BV11031_RS05575 (BV11031_05545) - 1025040..1026392 (-) 1353 WP_129550697.1 IS1182 family transposase -
  BV11031_RS05585 (BV11031_05555) comGA 1026689..1027759 (+) 1071 WP_010328244.1 competence protein ComGA Machinery gene
  BV11031_RS05590 (BV11031_05560) comGB 1027746..1028783 (+) 1038 WP_010328245.1 competence type IV pilus assembly protein ComGB Machinery gene
  BV11031_RS05595 (BV11031_05565) comGC 1028797..1029093 (+) 297 WP_010328246.1 comG operon protein ComGC Machinery gene
  BV11031_RS05600 (BV11031_05570) comGD 1029083..1029511 (+) 429 WP_010328247.1 competence type IV pilus minor pilin ComGD Machinery gene
  BV11031_RS05605 (BV11031_05575) comGE 1029495..1029842 (+) 348 WP_010328248.1 competence type IV pilus minor pilin ComGE Machinery gene
  BV11031_RS05610 (BV11031_05580) comGF 1029868..1030251 (+) 384 WP_026014434.1 competence type IV pilus minor pilin ComGF Machinery gene
  BV11031_RS05615 (BV11031_05585) comGG 1030252..1030626 (+) 375 WP_010328250.1 competence type IV pilus minor pilin ComGG Machinery gene
  BV11031_RS05620 (BV11031_05590) - 1030698..1030877 (+) 180 WP_010328251.1 YqzE family protein -
  BV11031_RS05625 (BV11031_05595) - 1030921..1031247 (-) 327 WP_026014435.1 YqzG/YhdC family protein -
  BV11031_RS05630 (BV11031_05600) tapA 1031516..1032280 (+) 765 WP_010328253.1 amyloid fiber anchoring/assembly protein TapA -
  BV11031_RS05635 (BV11031_05605) - 1032264..1032836 (+) 573 WP_082246288.1 signal peptidase I -
  BV11031_RS05640 (BV11031_05610) - 1032899..1033684 (+) 786 WP_010328256.1 TasA family protein -
  BV11031_RS05645 (BV11031_05615) - 1033823..1035175 (+) 1353 WP_129550698.1 IS1182 family transposase -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14364.54 Da        Isoelectric Point: 5.5519

>NTDB_id=268817 BV11031_RS05610 WP_026014434.1 1029868..1030251(+) (comGF) [Bacillus vallismortis strain DSM 11031]
MLLSGSLAMIFHLFLLRQQEHEGFTEQEWMISVEQMMNECKQSPAVKTAERGSVLICTTSSGQDIRFEAYHSMIRKRVDG
KGHVPILDHITAMKAEIENGIVLMKVESENQEVYQTAFPVYPYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=268817 BV11031_RS05610 WP_026014434.1 1029868..1030251(+) (comGF) [Bacillus vallismortis strain DSM 11031]
TTGCTCTTATCAGGATCGTTAGCTATGATCTTTCATCTGTTTTTGTTGCGCCAGCAGGAACATGAGGGTTTCACAGAGCA
AGAATGGATGATTTCGGTGGAGCAAATGATGAACGAGTGCAAGCAGTCACCCGCAGTCAAGACAGCCGAGCGTGGGAGCG
TGTTGATCTGTACCACTTCTTCTGGGCAAGATATCCGTTTTGAAGCCTATCACTCCATGATACGAAAAAGGGTGGATGGC
AAAGGGCATGTTCCGATTCTAGATCATATCACAGCGATGAAAGCTGAGATTGAAAACGGGATTGTTTTGATGAAAGTTGA
AAGTGAGAATCAAGAAGTGTATCAAACTGCATTTCCCGTTTACCCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

83.465

100

0.835


Multiple sequence alignment