Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   C2I05_RS02215 Genome accession   NZ_CP026039
Coordinates   382501..382884 (-) Length   127 a.a.
NCBI ID   WP_070547529.1    Uniprot ID   -
Organism   Bacillus subtilis strain PK1_2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 377501..387884
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2I05_RS02175 (C2I05_02150) sinI 378435..378608 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  C2I05_RS02180 (C2I05_02155) sinR 378642..378977 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2I05_RS02185 (C2I05_02160) tasA 379069..379854 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2I05_RS02190 (C2I05_02165) sipW 379919..380491 (-) 573 WP_003246088.1 signal peptidase I SipW -
  C2I05_RS02195 (C2I05_02170) tapA 380475..381236 (-) 762 WP_120028361.1 amyloid fiber anchoring/assembly protein TapA -
  C2I05_RS02200 (C2I05_02175) yqzG 381507..381833 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2I05_RS02205 (C2I05_02180) spoIIT 381875..382054 (-) 180 WP_003230176.1 YqzE family protein -
  C2I05_RS02210 (C2I05_02185) comGG 382126..382500 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  C2I05_RS02215 (C2I05_02190) comGF 382501..382884 (-) 384 WP_070547529.1 ComG operon protein ComGF Machinery gene
  C2I05_RS02220 (C2I05_02195) comGE 382910..383257 (-) 348 WP_070547530.1 ComG operon protein 5 Machinery gene
  C2I05_RS02225 (C2I05_02200) comGD 383241..383672 (-) 432 WP_120028362.1 comG operon protein ComGD Machinery gene
  C2I05_RS02230 (C2I05_02205) comGC 383662..383958 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  C2I05_RS02235 (C2I05_02210) comGB 383972..385009 (-) 1038 WP_070547532.1 comG operon protein ComGB Machinery gene
  C2I05_RS02240 (C2I05_02215) comGA 384996..386066 (-) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  C2I05_RS21445 (C2I05_02220) - 386277..386411 (-) 135 WP_257786427.1 hypothetical protein -
  C2I05_RS02245 (C2I05_02225) corA 386477..387430 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14257.35 Da        Isoelectric Point: 6.2112

>NTDB_id=265823 C2I05_RS02215 WP_070547529.1 382501..382884(-) (comGF) [Bacillus subtilis strain PK1_2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKASQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=265823 C2I05_RS02215 WP_070547529.1 382501..382884(-) (comGF) [Bacillus subtilis strain PK1_2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGCGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment