Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   C2I05_RS02175 Genome accession   NZ_CP026039
Coordinates   378435..378608 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain PK1_2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 373435..383608
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2I05_RS02160 (C2I05_02130) gcvT 374233..375321 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  C2I05_RS02165 (C2I05_02135) yqhH 375763..377436 (+) 1674 WP_120028360.1 SNF2-related protein -
  C2I05_RS02170 (C2I05_02140) yqhG 377457..378251 (+) 795 WP_032726154.1 YqhG family protein -
  C2I05_RS02175 (C2I05_02150) sinI 378435..378608 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  C2I05_RS02180 (C2I05_02155) sinR 378642..378977 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2I05_RS02185 (C2I05_02160) tasA 379069..379854 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2I05_RS02190 (C2I05_02165) sipW 379919..380491 (-) 573 WP_003246088.1 signal peptidase I SipW -
  C2I05_RS02195 (C2I05_02170) tapA 380475..381236 (-) 762 WP_120028361.1 amyloid fiber anchoring/assembly protein TapA -
  C2I05_RS02200 (C2I05_02175) yqzG 381507..381833 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2I05_RS02205 (C2I05_02180) spoIIT 381875..382054 (-) 180 WP_003230176.1 YqzE family protein -
  C2I05_RS02210 (C2I05_02185) comGG 382126..382500 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  C2I05_RS02215 (C2I05_02190) comGF 382501..382884 (-) 384 WP_070547529.1 ComG operon protein ComGF Machinery gene
  C2I05_RS02220 (C2I05_02195) comGE 382910..383257 (-) 348 WP_070547530.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=265820 C2I05_RS02175 WP_014477323.1 378435..378608(+) (sinI) [Bacillus subtilis strain PK1_2]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=265820 C2I05_RS02175 WP_014477323.1 378435..378608(+) (sinI) [Bacillus subtilis strain PK1_2]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982


Multiple sequence alignment