Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   C2H95_RS15525 Genome accession   NZ_CP026037
Coordinates   3033546..3033719 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain PK5_17     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3028546..3038719
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H95_RS15510 (C2H95_15440) gcvT 3029344..3030432 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  C2H95_RS15515 (C2H95_15445) yqhH 3030874..3032547 (+) 1674 WP_038829735.1 SNF2-related protein -
  C2H95_RS15520 (C2H95_15450) yqhG 3032568..3033362 (+) 795 WP_032726154.1 YqhG family protein -
  C2H95_RS15525 (C2H95_15460) sinI 3033546..3033719 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  C2H95_RS15530 (C2H95_15465) sinR 3033753..3034088 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2H95_RS15535 (C2H95_15470) tasA 3034180..3034965 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2H95_RS15540 (C2H95_15475) sipW 3035030..3035602 (-) 573 WP_003246088.1 signal peptidase I SipW -
  C2H95_RS15545 (C2H95_15480) tapA 3035586..3036347 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  C2H95_RS15550 (C2H95_15485) yqzG 3036618..3036944 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2H95_RS15555 (C2H95_15490) spoIIT 3036986..3037165 (-) 180 WP_014480252.1 YqzE family protein -
  C2H95_RS15560 (C2H95_15495) comGG 3037237..3037611 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  C2H95_RS15565 (C2H95_15500) comGF 3037612..3037995 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C2H95_RS15570 (C2H95_15505) comGE 3038021..3038368 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=265713 C2H95_RS15525 WP_014477323.1 3033546..3033719(+) (sinI) [Bacillus subtilis strain PK5_17]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=265713 C2H95_RS15525 WP_014477323.1 3033546..3033719(+) (sinI) [Bacillus subtilis strain PK5_17]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment