Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   C2H95_RS15565 Genome accession   NZ_CP026037
Coordinates   3037612..3037995 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus subtilis strain PK5_17     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3032612..3042995
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H95_RS15525 (C2H95_15460) sinI 3033546..3033719 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  C2H95_RS15530 (C2H95_15465) sinR 3033753..3034088 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2H95_RS15535 (C2H95_15470) tasA 3034180..3034965 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2H95_RS15540 (C2H95_15475) sipW 3035030..3035602 (-) 573 WP_003246088.1 signal peptidase I SipW -
  C2H95_RS15545 (C2H95_15480) tapA 3035586..3036347 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  C2H95_RS15550 (C2H95_15485) yqzG 3036618..3036944 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2H95_RS15555 (C2H95_15490) spoIIT 3036986..3037165 (-) 180 WP_014480252.1 YqzE family protein -
  C2H95_RS15560 (C2H95_15495) comGG 3037237..3037611 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  C2H95_RS15565 (C2H95_15500) comGF 3037612..3037995 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C2H95_RS15570 (C2H95_15505) comGE 3038021..3038368 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene
  C2H95_RS15575 (C2H95_15510) comGD 3038352..3038783 (-) 432 WP_032726159.1 competence type IV pilus minor pilin ComGD Machinery gene
  C2H95_RS15580 (C2H95_15515) comGC 3038773..3039069 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  C2H95_RS15585 (C2H95_15520) comGB 3039083..3040120 (-) 1038 WP_103803302.1 comG operon protein ComGB Machinery gene
  C2H95_RS15590 (C2H95_15525) comGA 3040107..3041177 (-) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  C2H95_RS15595 (C2H95_15530) - 3041388..3041585 (-) 198 WP_103803301.1 hypothetical protein -
  C2H95_RS15600 (C2H95_15535) corA 3041587..3042540 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=265716 C2H95_RS15565 WP_032726158.1 3037612..3037995(-) (comGF) [Bacillus subtilis strain PK5_17]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=265716 C2H95_RS15565 WP_032726158.1 3037612..3037995(-) (comGF) [Bacillus subtilis strain PK5_17]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCATATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment