Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   C2H96_RS20145 Genome accession   NZ_CP026035
Coordinates   3916221..3916604 (+) Length   127 a.a.
NCBI ID   WP_070547529.1    Uniprot ID   -
Organism   Bacillus subtilis strain PK5_68     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3911221..3921604
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H96_RS20115 (C2H96_20055) corA 3911675..3912628 (+) 954 WP_015483432.1 magnesium transporter CorA -
  C2H96_RS21525 (C2H96_20060) - 3912694..3912828 (+) 135 WP_257786427.1 hypothetical protein -
  C2H96_RS20120 (C2H96_20065) comGA 3913039..3914109 (+) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  C2H96_RS20125 (C2H96_20070) comGB 3914096..3915133 (+) 1038 WP_070547532.1 comG operon protein ComGB Machinery gene
  C2H96_RS20130 (C2H96_20075) comGC 3915147..3915443 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  C2H96_RS20135 (C2H96_20080) comGD 3915433..3915864 (+) 432 WP_120028362.1 comG operon protein ComGD Machinery gene
  C2H96_RS20140 (C2H96_20085) comGE 3915848..3916195 (+) 348 WP_070547530.1 ComG operon protein 5 Machinery gene
  C2H96_RS20145 (C2H96_20090) comGF 3916221..3916604 (+) 384 WP_070547529.1 ComG operon protein ComGF Machinery gene
  C2H96_RS20150 (C2H96_20095) comGG 3916605..3916979 (+) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  C2H96_RS20155 (C2H96_20100) spoIIT 3917051..3917230 (+) 180 WP_003230176.1 YqzE family protein -
  C2H96_RS20160 (C2H96_20105) yqzG 3917272..3917598 (-) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2H96_RS20165 (C2H96_20110) tapA 3917869..3918630 (+) 762 WP_120028361.1 amyloid fiber anchoring/assembly protein TapA -
  C2H96_RS20170 (C2H96_20115) sipW 3918614..3919186 (+) 573 WP_003246088.1 signal peptidase I SipW -
  C2H96_RS20175 (C2H96_20120) tasA 3919251..3920036 (+) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2H96_RS20180 (C2H96_20125) sinR 3920128..3920463 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2H96_RS20185 (C2H96_20130) sinI 3920497..3920670 (-) 174 WP_014477323.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14257.35 Da        Isoelectric Point: 6.2112

>NTDB_id=265575 C2H96_RS20145 WP_070547529.1 3916221..3916604(+) (comGF) [Bacillus subtilis strain PK5_68]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKASQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=265575 C2H96_RS20145 WP_070547529.1 3916221..3916604(+) (comGF) [Bacillus subtilis strain PK5_68]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGCGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment