Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   CXR48_RS11815 Genome accession   NZ_CP025341
Coordinates   2474036..2474209 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain CMT-6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2469036..2479209
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CXR48_RS11800 gcvT 2469854..2470954 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  CXR48_RS11805 - 2471377..2473047 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  CXR48_RS11810 - 2473065..2473859 (+) 795 WP_014305407.1 YqhG family protein -
  CXR48_RS11815 sinI 2474036..2474209 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CXR48_RS11820 sinR 2474243..2474578 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CXR48_RS11825 tasA 2474626..2475411 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  CXR48_RS11830 sipW 2475475..2476059 (-) 585 WP_012117977.1 signal peptidase I SipW -
  CXR48_RS11835 tapA 2476031..2476702 (-) 672 WP_063174755.1 amyloid fiber anchoring/assembly protein TapA -
  CXR48_RS11840 - 2476961..2477290 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  CXR48_RS11845 - 2477330..2477509 (-) 180 WP_003153093.1 YqzE family protein -
  CXR48_RS11850 comGG 2477566..2477943 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  CXR48_RS11855 comGF 2477944..2478444 (-) 501 WP_232789965.1 competence type IV pilus minor pilin ComGF -
  CXR48_RS11860 comGE 2478353..2478667 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  CXR48_RS11865 comGD 2478651..2479088 (-) 438 WP_095318402.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=260170 CXR48_RS11815 WP_003153105.1 2474036..2474209(+) (sinI) [Bacillus velezensis strain CMT-6]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=260170 CXR48_RS11815 WP_003153105.1 2474036..2474209(+) (sinI) [Bacillus velezensis strain CMT-6]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment