Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CXR48_RS11815 | Genome accession | NZ_CP025341 |
| Coordinates | 2474036..2474209 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain CMT-6 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2469036..2479209
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXR48_RS11800 | gcvT | 2469854..2470954 (-) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CXR48_RS11805 | - | 2471377..2473047 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| CXR48_RS11810 | - | 2473065..2473859 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| CXR48_RS11815 | sinI | 2474036..2474209 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| CXR48_RS11820 | sinR | 2474243..2474578 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CXR48_RS11825 | tasA | 2474626..2475411 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| CXR48_RS11830 | sipW | 2475475..2476059 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| CXR48_RS11835 | tapA | 2476031..2476702 (-) | 672 | WP_063174755.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CXR48_RS11840 | - | 2476961..2477290 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| CXR48_RS11845 | - | 2477330..2477509 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| CXR48_RS11850 | comGG | 2477566..2477943 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CXR48_RS11855 | comGF | 2477944..2478444 (-) | 501 | WP_232789965.1 | competence type IV pilus minor pilin ComGF | - |
| CXR48_RS11860 | comGE | 2478353..2478667 (-) | 315 | WP_041481885.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| CXR48_RS11865 | comGD | 2478651..2479088 (-) | 438 | WP_095318402.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=260170 CXR48_RS11815 WP_003153105.1 2474036..2474209(+) (sinI) [Bacillus velezensis strain CMT-6]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=260170 CXR48_RS11815 WP_003153105.1 2474036..2474209(+) (sinI) [Bacillus velezensis strain CMT-6]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |