Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   CXR48_RS11860 Genome accession   NZ_CP025341
Coordinates   2478353..2478667 (-) Length   104 a.a.
NCBI ID   WP_041481885.1    Uniprot ID   -
Organism   Bacillus velezensis strain CMT-6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2473353..2483667
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CXR48_RS11815 sinI 2474036..2474209 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CXR48_RS11820 sinR 2474243..2474578 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CXR48_RS11825 tasA 2474626..2475411 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  CXR48_RS11830 sipW 2475475..2476059 (-) 585 WP_012117977.1 signal peptidase I SipW -
  CXR48_RS11835 tapA 2476031..2476702 (-) 672 WP_063174755.1 amyloid fiber anchoring/assembly protein TapA -
  CXR48_RS11840 - 2476961..2477290 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  CXR48_RS11845 - 2477330..2477509 (-) 180 WP_003153093.1 YqzE family protein -
  CXR48_RS11850 comGG 2477566..2477943 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  CXR48_RS11855 comGF 2477944..2478444 (-) 501 WP_232789965.1 competence type IV pilus minor pilin ComGF -
  CXR48_RS11860 comGE 2478353..2478667 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  CXR48_RS11865 comGD 2478651..2479088 (-) 438 WP_095318402.1 competence type IV pilus minor pilin ComGD Machinery gene
  CXR48_RS11870 comGC 2479078..2479386 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  CXR48_RS11875 comGB 2479391..2480428 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  CXR48_RS11880 comGA 2480415..2481485 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  CXR48_RS11885 - 2481677..2482627 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11830.82 Da        Isoelectric Point: 6.9470

>NTDB_id=260173 CXR48_RS11860 WP_041481885.1 2478353..2478667(-) (comGE) [Bacillus velezensis strain CMT-6]
MLNGNKGFSTIETLSAMAVWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=260173 CXR48_RS11860 WP_041481885.1 2478353..2478667(-) (comGE) [Bacillus velezensis strain CMT-6]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCGTTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment