Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   CXP43_RS13115 Genome accession   NZ_CP025308
Coordinates   2644926..2645303 (-) Length   125 a.a.
NCBI ID   WP_014418373.1    Uniprot ID   I2C7P9
Organism   Bacillus velezensis strain Lzh-a42     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2639926..2650303
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CXP43_RS13075 (CXP43_13075) - 2640423..2641217 (+) 795 WP_014418368.1 YqhG family protein -
  CXP43_RS13080 (CXP43_13080) sinI 2641394..2641567 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  CXP43_RS13085 (CXP43_13085) sinR 2641601..2641936 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CXP43_RS13090 (CXP43_13090) tasA 2641984..2642769 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CXP43_RS13095 (CXP43_13095) sipW 2642834..2643418 (-) 585 WP_014418370.1 signal peptidase I SipW -
  CXP43_RS13100 (CXP43_13100) tapA 2643390..2644061 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  CXP43_RS13105 (CXP43_13105) - 2644320..2644649 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  CXP43_RS13110 (CXP43_13110) - 2644690..2644869 (-) 180 WP_003153093.1 YqzE family protein -
  CXP43_RS13115 (CXP43_13115) comGG 2644926..2645303 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  CXP43_RS13120 (CXP43_13120) comGF 2645304..2645804 (-) 501 WP_014418374.1 competence type IV pilus minor pilin ComGF -
  CXP43_RS13125 (CXP43_13125) comGE 2645713..2646027 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  CXP43_RS13130 (CXP43_13130) comGD 2646011..2646448 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  CXP43_RS13135 (CXP43_13135) comGC 2646438..2646746 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  CXP43_RS13140 (CXP43_13140) comGB 2646751..2647788 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  CXP43_RS13145 (CXP43_13145) comGA 2647775..2648845 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  CXP43_RS13150 (CXP43_13150) - 2649038..2649988 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14119.10 Da        Isoelectric Point: 9.9337

>NTDB_id=259976 CXP43_RS13115 WP_014418373.1 2644926..2645303(-) (comGG) [Bacillus velezensis strain Lzh-a42]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVKVTIQAETMTGTRREATLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=259976 CXP43_RS13115 WP_014418373.1 2644926..2645303(-) (comGG) [Bacillus velezensis strain Lzh-a42]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGCCGGGAAACGGTTAAGGTTACAATTCAGGCGGAAACCATGACAGGCACGAGACGGGA
GGCTACCCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment