Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CXP43_RS13080 | Genome accession | NZ_CP025308 |
| Coordinates | 2641394..2641567 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain Lzh-a42 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2636394..2646567
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXP43_RS13065 (CXP43_13065) | gcvT | 2637207..2638307 (-) | 1101 | WP_014418366.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CXP43_RS13070 (CXP43_13070) | - | 2638731..2640401 (+) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| CXP43_RS13075 (CXP43_13075) | - | 2640423..2641217 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| CXP43_RS13080 (CXP43_13080) | sinI | 2641394..2641567 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| CXP43_RS13085 (CXP43_13085) | sinR | 2641601..2641936 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CXP43_RS13090 (CXP43_13090) | tasA | 2641984..2642769 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| CXP43_RS13095 (CXP43_13095) | sipW | 2642834..2643418 (-) | 585 | WP_014418370.1 | signal peptidase I SipW | - |
| CXP43_RS13100 (CXP43_13100) | tapA | 2643390..2644061 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CXP43_RS13105 (CXP43_13105) | - | 2644320..2644649 (+) | 330 | WP_014418372.1 | DUF3889 domain-containing protein | - |
| CXP43_RS13110 (CXP43_13110) | - | 2644690..2644869 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| CXP43_RS13115 (CXP43_13115) | comGG | 2644926..2645303 (-) | 378 | WP_014418373.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CXP43_RS13120 (CXP43_13120) | comGF | 2645304..2645804 (-) | 501 | WP_014418374.1 | competence type IV pilus minor pilin ComGF | - |
| CXP43_RS13125 (CXP43_13125) | comGE | 2645713..2646027 (-) | 315 | WP_032863566.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| CXP43_RS13130 (CXP43_13130) | comGD | 2646011..2646448 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=259974 CXP43_RS13080 WP_014418369.1 2641394..2641567(+) (sinI) [Bacillus velezensis strain Lzh-a42]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=259974 CXP43_RS13080 WP_014418369.1 2641394..2641567(+) (sinI) [Bacillus velezensis strain Lzh-a42]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |