Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   CXL14_RS11325 Genome accession   NZ_CP025258
Coordinates   2203878..2204255 (+) Length   125 a.a.
NCBI ID   WP_014418373.1    Uniprot ID   I2C7P9
Organism   Bacillus sp. SJ-10     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2198878..2209255
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CXL14_RS11290 - 2199193..2200143 (+) 951 WP_014418379.1 magnesium transporter CorA family protein -
  CXL14_RS11295 comGA 2200336..2201406 (+) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  CXL14_RS11300 comGB 2201393..2202430 (+) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  CXL14_RS11305 comGC 2202477..2202743 (+) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  CXL14_RS11310 comGD 2202733..2203170 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  CXL14_RS11315 comGE 2203154..2203468 (+) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  CXL14_RS11320 comGF 2203482..2203877 (+) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  CXL14_RS11325 comGG 2203878..2204255 (+) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  CXL14_RS11330 - 2204312..2204491 (+) 180 WP_003153093.1 YqzE family protein -
  CXL14_RS11335 - 2204532..2204861 (-) 330 WP_014418372.1 DUF3889 domain-containing protein -
  CXL14_RS11340 tapA 2205120..2205791 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  CXL14_RS11345 - 2205763..2206347 (+) 585 WP_014418370.1 signal peptidase I -
  CXL14_RS11350 - 2206412..2207197 (+) 786 WP_007408329.1 TasA family protein -
  CXL14_RS11355 sinR 2207245..2207580 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CXL14_RS11360 sinI 2207614..2207787 (-) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  CXL14_RS11365 - 2207964..2208758 (-) 795 WP_014418368.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14119.10 Da        Isoelectric Point: 9.9337

>NTDB_id=259562 CXL14_RS11325 WP_014418373.1 2203878..2204255(+) (comGG) [Bacillus sp. SJ-10]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVKVTIQAETMTGTRREATLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=259562 CXL14_RS11325 WP_014418373.1 2203878..2204255(+) (comGG) [Bacillus sp. SJ-10]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGCCGGGAAACGGTTAAGGTTACAATTCAGGCGGAAACCATGACAGGCACGAGACGGGA
GGCTACCCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment