Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   CXL14_RS11360 Genome accession   NZ_CP025258
Coordinates   2207614..2207787 (-) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus sp. SJ-10     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2202614..2212787
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CXL14_RS11310 comGD 2202733..2203170 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  CXL14_RS11315 comGE 2203154..2203468 (+) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  CXL14_RS11320 comGF 2203482..2203877 (+) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  CXL14_RS11325 comGG 2203878..2204255 (+) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  CXL14_RS11330 - 2204312..2204491 (+) 180 WP_003153093.1 YqzE family protein -
  CXL14_RS11335 - 2204532..2204861 (-) 330 WP_014418372.1 DUF3889 domain-containing protein -
  CXL14_RS11340 tapA 2205120..2205791 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  CXL14_RS11345 - 2205763..2206347 (+) 585 WP_014418370.1 signal peptidase I -
  CXL14_RS11350 - 2206412..2207197 (+) 786 WP_007408329.1 TasA family protein -
  CXL14_RS11355 sinR 2207245..2207580 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CXL14_RS11360 sinI 2207614..2207787 (-) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  CXL14_RS11365 - 2207964..2208758 (-) 795 WP_014418368.1 YqhG family protein -
  CXL14_RS11370 - 2208780..2210450 (-) 1671 WP_021494309.1 SNF2-related protein -
  CXL14_RS11375 gcvT 2210874..2211974 (+) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=259564 CXL14_RS11360 WP_014418369.1 2207614..2207787(-) (sinI) [Bacillus sp. SJ-10]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=259564 CXL14_RS11360 WP_014418369.1 2207614..2207787(-) (sinI) [Bacillus sp. SJ-10]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment