Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   CWD84_RS20020 Genome accession   NZ_CP025001
Coordinates   3881781..3881900 (-) Length   39 a.a.
NCBI ID   WP_016937261.1    Uniprot ID   -
Organism   Bacillus siamensis strain SCSIO 05746     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3876781..3886900
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CWD84_RS19995 (CWD84_19990) - 3877022..3877780 (-) 759 WP_047476235.1 ABC transporter ATP-binding protein -
  CWD84_RS20000 (CWD84_19995) - 3877774..3878721 (-) 948 WP_045926247.1 iron chelate uptake ABC transporter family permease subunit -
  CWD84_RS20005 (CWD84_20000) ceuB 3878711..3879664 (-) 954 WP_101605585.1 ABC transporter permease Machinery gene
  CWD84_RS20010 (CWD84_20005) - 3880080..3881444 (+) 1365 WP_060963607.1 aspartate kinase -
  CWD84_RS20015 (CWD84_20010) - 3881540..3881638 (+) 99 WP_016937260.1 YjcZ family sporulation protein -
  CWD84_RS20020 (CWD84_20015) phrC 3881781..3881900 (-) 120 WP_016937261.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  CWD84_RS20025 (CWD84_20020) rapC 3881884..3883032 (-) 1149 WP_045926250.1 tetratricopeptide repeat protein Regulator
  CWD84_RS20030 (CWD84_20025) - 3883186..3884619 (-) 1434 WP_162492439.1 sensor histidine kinase -
  CWD84_RS20035 (CWD84_20030) - 3884606..3885289 (-) 684 WP_060963609.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=257118 CWD84_RS20020 WP_016937261.1 3881781..3881900(-) (phrC) [Bacillus siamensis strain SCSIO 05746]
MKLKSKWFVICLAAAAIFTVAGAGQTDQADFHVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=257118 CWD84_RS20020 WP_016937261.1 3881781..3881900(-) (phrC) [Bacillus siamensis strain SCSIO 05746]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTTGCAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAACTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

77.5

100

0.795


Multiple sequence alignment