Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | CWD84_RS04960 | Genome accession | NZ_CP025001 |
| Coordinates | 944113..944253 (+) | Length | 46 a.a. |
| NCBI ID | WP_013353398.1 | Uniprot ID | P06532 |
| Organism | Bacillus siamensis strain SCSIO 05746 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 939113..949253
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CWD84_RS04930 (CWD84_04930) | - | 939426..939824 (+) | 399 | WP_060964418.1 | YueI family protein | - |
| CWD84_RS04935 (CWD84_04935) | - | 939913..940464 (+) | 552 | WP_060964419.1 | cysteine hydrolase family protein | - |
| CWD84_RS04940 (CWD84_04940) | - | 940482..941948 (+) | 1467 | WP_101605399.1 | nicotinate phosphoribosyltransferase | - |
| CWD84_RS04945 (CWD84_04945) | - | 942078..943301 (+) | 1224 | WP_060964420.1 | EAL and HDOD domain-containing protein | - |
| CWD84_RS04950 (CWD84_04950) | - | 943306..943647 (-) | 342 | WP_060964421.1 | hypothetical protein | - |
| CWD84_RS04960 (CWD84_04960) | degQ | 944113..944253 (+) | 141 | WP_013353398.1 | degradation enzyme regulation protein DegQ | Regulator |
| CWD84_RS04965 (CWD84_04965) | - | 944405..945280 (+) | 876 | WP_060965112.1 | polyprenyl synthetase family protein | - |
| CWD84_RS04970 (CWD84_04970) | comX | 945295..945471 (+) | 177 | WP_044052947.1 | competence pheromone ComX | - |
| CWD84_RS04975 (CWD84_04975) | comP | 945490..947796 (+) | 2307 | WP_060964422.1 | sensor histidine kinase | Regulator |
| CWD84_RS04980 (CWD84_04980) | comA | 947877..948521 (+) | 645 | WP_016938117.1 | response regulator transcription factor | Regulator |
| CWD84_RS04985 (CWD84_04985) | - | 948543..948926 (+) | 384 | WP_060964423.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5532.37 Da Isoelectric Point: 6.2567
>NTDB_id=257066 CWD84_RS04960 WP_013353398.1 944113..944253(+) (degQ) [Bacillus siamensis strain SCSIO 05746]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=257066 CWD84_RS04960 WP_013353398.1 944113..944253(+) (degQ) [Bacillus siamensis strain SCSIO 05746]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCTTTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCTTTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
91.304 |
100 |
0.913 |