Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   CV702_RS10865 Genome accession   NZ_CP024954
Coordinates   2243779..2244063 (-) Length   94 a.a.
NCBI ID   WP_017865155.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain F44     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2238779..2249063
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CV702_RS10830 (CV702_10840) rpmG 2239058..2239207 (-) 150 WP_010906305.1 50S ribosomal protein L33 -
  CV702_RS10835 (CV702_10845) - 2239248..2240363 (-) 1116 Protein_2124 acyltransferase family protein -
  CV702_RS10840 (CV702_10850) - 2240374..2240667 (+) 294 WP_226898169.1 pseudouridine synthase -
  CV702_RS10845 (CV702_10855) - 2240706..2241515 (-) 810 WP_014570791.1 metal ABC transporter permease -
  CV702_RS10850 (CV702_10860) - 2241508..2242245 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  CV702_RS10855 (CV702_10865) - 2242422..2243264 (-) 843 WP_017865154.1 metal ABC transporter substrate-binding protein -
  CV702_RS10860 (CV702_10870) - 2243261..2243698 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  CV702_RS10865 (CV702_10875) comGG 2243779..2244063 (-) 285 WP_017865155.1 competence type IV pilus minor pilin ComGG Machinery gene
  CV702_RS10870 (CV702_10880) comGF 2244102..2244548 (-) 447 WP_032948129.1 competence type IV pilus minor pilin ComGF Machinery gene
  CV702_RS10875 (CV702_10885) comGE 2244511..2244807 (-) 297 WP_017865157.1 competence type IV pilus minor pilin ComGE Machinery gene
  CV702_RS10880 (CV702_10890) comGD 2244779..2245210 (-) 432 WP_026138965.1 competence type IV pilus minor pilin ComGD Machinery gene
  CV702_RS10885 (CV702_10895) comGC 2245170..2245505 (-) 336 WP_032948139.1 competence type IV pilus major pilin ComGC Machinery gene
  CV702_RS10890 (CV702_10900) comGB 2245567..2246640 (-) 1074 WP_080613278.1 competence type IV pilus assembly protein ComGB Machinery gene
  CV702_RS10895 (CV702_10905) comGA 2246534..2247472 (-) 939 WP_026138968.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10782.04 Da        Isoelectric Point: 5.5720

>NTDB_id=256730 CV702_RS10865 WP_017865155.1 2243779..2244063(-) (comGG) [Lactococcus lactis subsp. lactis strain F44]
MFSMFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=256730 CV702_RS10865 WP_017865155.1 2243779..2244063(-) (comGG) [Lactococcus lactis subsp. lactis strain F44]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

60.215

98.936

0.596


Multiple sequence alignment