Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   CS547_RS12070 Genome accession   NZ_CP024647
Coordinates   2471981..2472358 (-) Length   125 a.a.
NCBI ID   WP_022552965.1    Uniprot ID   -
Organism   Bacillus velezensis strain Lzh-5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2466981..2477358
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CS547_RS12030 (CS547_12020) - 2467478..2468272 (+) 795 WP_014418368.1 YqhG family protein -
  CS547_RS12035 (CS547_12025) sinI 2468449..2468622 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  CS547_RS12040 (CS547_12030) sinR 2468656..2468991 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CS547_RS12045 (CS547_12035) tasA 2469039..2469824 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CS547_RS12050 (CS547_12040) sipW 2469889..2470473 (-) 585 WP_022552967.1 signal peptidase I SipW -
  CS547_RS12055 (CS547_12045) tapA 2470445..2471116 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  CS547_RS12060 (CS547_12050) - 2471375..2471704 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CS547_RS12065 (CS547_12055) - 2471745..2471924 (-) 180 WP_022552966.1 YqzE family protein -
  CS547_RS12070 (CS547_12060) comGG 2471981..2472358 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  CS547_RS12075 (CS547_12065) comGF 2472359..2472754 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  CS547_RS12080 (CS547_12070) comGE 2472768..2473082 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  CS547_RS12085 (CS547_12075) comGD 2473066..2473503 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  CS547_RS12090 (CS547_12080) comGC 2473493..2473801 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  CS547_RS12095 (CS547_12085) comGB 2473806..2474843 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  CS547_RS12100 (CS547_12090) comGA 2474830..2475900 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  CS547_RS12105 (CS547_12095) - 2476093..2477043 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14207.16 Da        Isoelectric Point: 9.9338

>NTDB_id=254742 CS547_RS12070 WP_022552965.1 2471981..2472358(-) (comGG) [Bacillus velezensis strain Lzh-5]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHINGSDRRETVQVTIQAETKTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=254742 CS547_RS12070 WP_022552965.1 2471981..2472358(-) (comGG) [Bacillus velezensis strain Lzh-5]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCAACGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCAAGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504


Multiple sequence alignment