Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CS547_RS12035 | Genome accession | NZ_CP024647 |
| Coordinates | 2468449..2468622 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain Lzh-5 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2463449..2473622
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CS547_RS12020 (CS547_12010) | gcvT | 2464262..2465362 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CS547_RS12025 (CS547_12015) | - | 2465786..2467456 (+) | 1671 | WP_038461530.1 | DEAD/DEAH box helicase | - |
| CS547_RS12030 (CS547_12020) | - | 2467478..2468272 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| CS547_RS12035 (CS547_12025) | sinI | 2468449..2468622 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| CS547_RS12040 (CS547_12030) | sinR | 2468656..2468991 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CS547_RS12045 (CS547_12035) | tasA | 2469039..2469824 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| CS547_RS12050 (CS547_12040) | sipW | 2469889..2470473 (-) | 585 | WP_022552967.1 | signal peptidase I SipW | - |
| CS547_RS12055 (CS547_12045) | tapA | 2470445..2471116 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CS547_RS12060 (CS547_12050) | - | 2471375..2471704 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| CS547_RS12065 (CS547_12055) | - | 2471745..2471924 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| CS547_RS12070 (CS547_12060) | comGG | 2471981..2472358 (-) | 378 | WP_022552965.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CS547_RS12075 (CS547_12065) | comGF | 2472359..2472754 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| CS547_RS12080 (CS547_12070) | comGE | 2472768..2473082 (-) | 315 | WP_021494312.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| CS547_RS12085 (CS547_12075) | comGD | 2473066..2473503 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=254740 CS547_RS12035 WP_014418369.1 2468449..2468622(+) (sinI) [Bacillus velezensis strain Lzh-5]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=254740 CS547_RS12035 WP_014418369.1 2468449..2468622(+) (sinI) [Bacillus velezensis strain Lzh-5]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |