Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   CS376_RS12850 Genome accession   NZ_CP024203
Coordinates   2608619..2608996 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain NKG-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2603619..2613996
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CS376_RS12810 - 2604117..2604911 (+) 795 WP_015240204.1 YqhG family protein -
  CS376_RS12815 sinI 2605088..2605261 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CS376_RS12820 sinR 2605295..2605630 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CS376_RS12825 tasA 2605678..2606463 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CS376_RS12830 sipW 2606528..2607112 (-) 585 WP_012117977.1 signal peptidase I SipW -
  CS376_RS12835 tapA 2607084..2607755 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  CS376_RS12840 - 2608014..2608343 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CS376_RS12845 - 2608383..2608562 (-) 180 WP_059368116.1 YqzE family protein -
  CS376_RS12850 comGG 2608619..2608996 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  CS376_RS12855 comGF 2608997..2609392 (-) 396 WP_043020788.1 competence type IV pilus minor pilin ComGF -
  CS376_RS12860 comGE 2609406..2609720 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  CS376_RS12865 comGD 2609704..2610141 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  CS376_RS12870 comGC 2610131..2610439 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  CS376_RS12875 comGB 2610444..2611481 (-) 1038 WP_099566903.1 competence type IV pilus assembly protein ComGB Machinery gene
  CS376_RS12880 comGA 2611468..2612538 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  CS376_RS12885 - 2612735..2613685 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=252909 CS376_RS12850 WP_012117980.1 2608619..2608996(-) (comGG) [Bacillus velezensis strain NKG-1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=252909 CS376_RS12850 WP_012117980.1 2608619..2608996(-) (comGG) [Bacillus velezensis strain NKG-1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment