Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   CS376_RS12815 Genome accession   NZ_CP024203
Coordinates   2605088..2605261 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain NKG-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2600088..2610261
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CS376_RS12800 gcvT 2600901..2602001 (-) 1101 WP_099566902.1 glycine cleavage system aminomethyltransferase GcvT -
  CS376_RS12805 - 2602425..2604095 (+) 1671 WP_025284995.1 DEAD/DEAH box helicase -
  CS376_RS12810 - 2604117..2604911 (+) 795 WP_015240204.1 YqhG family protein -
  CS376_RS12815 sinI 2605088..2605261 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CS376_RS12820 sinR 2605295..2605630 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CS376_RS12825 tasA 2605678..2606463 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CS376_RS12830 sipW 2606528..2607112 (-) 585 WP_012117977.1 signal peptidase I SipW -
  CS376_RS12835 tapA 2607084..2607755 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  CS376_RS12840 - 2608014..2608343 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CS376_RS12845 - 2608383..2608562 (-) 180 WP_059368116.1 YqzE family protein -
  CS376_RS12850 comGG 2608619..2608996 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  CS376_RS12855 comGF 2608997..2609392 (-) 396 WP_043020788.1 competence type IV pilus minor pilin ComGF -
  CS376_RS12860 comGE 2609406..2609720 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  CS376_RS12865 comGD 2609704..2610141 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=252907 CS376_RS12815 WP_003153105.1 2605088..2605261(+) (sinI) [Bacillus velezensis strain NKG-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=252907 CS376_RS12815 WP_003153105.1 2605088..2605261(+) (sinI) [Bacillus velezensis strain NKG-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment