Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CS376_RS12815 | Genome accession | NZ_CP024203 |
| Coordinates | 2605088..2605261 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain NKG-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2600088..2610261
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CS376_RS12800 | gcvT | 2600901..2602001 (-) | 1101 | WP_099566902.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CS376_RS12805 | - | 2602425..2604095 (+) | 1671 | WP_025284995.1 | DEAD/DEAH box helicase | - |
| CS376_RS12810 | - | 2604117..2604911 (+) | 795 | WP_015240204.1 | YqhG family protein | - |
| CS376_RS12815 | sinI | 2605088..2605261 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| CS376_RS12820 | sinR | 2605295..2605630 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CS376_RS12825 | tasA | 2605678..2606463 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| CS376_RS12830 | sipW | 2606528..2607112 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| CS376_RS12835 | tapA | 2607084..2607755 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CS376_RS12840 | - | 2608014..2608343 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| CS376_RS12845 | - | 2608383..2608562 (-) | 180 | WP_059368116.1 | YqzE family protein | - |
| CS376_RS12850 | comGG | 2608619..2608996 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CS376_RS12855 | comGF | 2608997..2609392 (-) | 396 | WP_043020788.1 | competence type IV pilus minor pilin ComGF | - |
| CS376_RS12860 | comGE | 2609406..2609720 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| CS376_RS12865 | comGD | 2609704..2610141 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=252907 CS376_RS12815 WP_003153105.1 2605088..2605261(+) (sinI) [Bacillus velezensis strain NKG-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=252907 CS376_RS12815 WP_003153105.1 2605088..2605261(+) (sinI) [Bacillus velezensis strain NKG-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |